Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 344276..344907 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | L4J012 |
Locus tag | QQA22_RS01660 | Protein ID | WP_001260301.1 |
Coordinates | 344632..344907 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IZA1 |
Locus tag | QQA22_RS01655 | Protein ID | WP_000593557.1 |
Coordinates | 344276..344635 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS01630 (340408) | 340408..341352 | + | 945 | WP_000947063.1 | nickel ABC transporter permease subunit NikB | - |
QQA22_RS01635 (341349) | 341349..342182 | + | 834 | WP_001008963.1 | nickel ABC transporter permease subunit NikC | - |
QQA22_RS01640 (342182) | 342182..342946 | + | 765 | WP_001136206.1 | nickel import ATP-binding protein NikD | - |
QQA22_RS01645 (342943) | 342943..343749 | + | 807 | WP_000173650.1 | nickel import ATP-binding protein NikE | - |
QQA22_RS01650 (343755) | 343755..344156 | + | 402 | WP_001190062.1 | nickel-responsive transcriptional regulator NikR | - |
QQA22_RS01655 (344276) | 344276..344635 | - | 360 | WP_000593557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QQA22_RS01660 (344632) | 344632..344907 | - | 276 | WP_001260301.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QQA22_RS01665 (344980) | 344980..346104 | - | 1125 | WP_001318088.1 | ABC transporter permease | - |
QQA22_RS01670 (346104) | 346104..348839 | - | 2736 | WP_000149178.1 | ribosome-associated ATPase/putative transporter RbbA | - |
QQA22_RS01675 (348836) | 348836..349903 | - | 1068 | WP_000361470.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10185.87 Da Isoelectric Point: 10.6128
>T283335 WP_001260301.1 NZ_CP126952:c344907-344632 [Escherichia coli O78:H4]
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13389.28 Da Isoelectric Point: 5.1987
>AT283335 WP_000593557.1 NZ_CP126952:c344635-344276 [Escherichia coli O78:H4]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLTNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLTNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|