Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 317051..317646 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | doc | Uniprot ID | D6JG31 |
Locus tag | QQA22_RS01505 | Protein ID | WP_000155159.1 |
Coordinates | 317051..317428 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | D6JG32 |
Locus tag | QQA22_RS01510 | Protein ID | WP_000557315.1 |
Coordinates | 317425..317646 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS01485 (312550) | 312550..313619 | - | 1070 | Protein_293 | sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC | - |
QQA22_RS01490 (313621) | 313621..314466 | - | 846 | WP_000572164.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
QQA22_RS01495 (314463) | 314463..315350 | - | 888 | WP_000099289.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
QQA22_RS01500 (315526) | 315526..316842 | - | 1317 | WP_000803191.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
QQA22_RS01505 (317051) | 317051..317428 | - | 378 | WP_000155159.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QQA22_RS01510 (317425) | 317425..317646 | - | 222 | WP_000557315.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QQA22_RS01515 (317734) | 317734..318447 | - | 714 | WP_000416895.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
QQA22_RS01520 (318449) | 318449..319216 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
QQA22_RS01525 (319213) | 319213..320490 | - | 1278 | WP_000803825.1 | branched chain amino acid ABC transporter permease LivM | - |
QQA22_RS01530 (320487) | 320487..321413 | - | 927 | WP_000003010.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QQA22_RS01535 (321461) | 321461..322570 | - | 1110 | WP_001318085.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 311810..320490 | 8680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13964.25 Da Isoelectric Point: 6.7263
>T283334 WP_000155159.1 NZ_CP126952:c317428-317051 [Escherichia coli O78:H4]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|