Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 44285..45120 | Replicon | chromosome |
| Accession | NZ_CP126952 | ||
| Organism | Escherichia coli O78:H4 strain APEC E12049 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | F4TIK8 |
| Locus tag | QQA22_RS00235 | Protein ID | WP_000854694.1 |
| Coordinates | 44285..44662 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8S7S1S5 |
| Locus tag | QQA22_RS00240 | Protein ID | WP_065793167.1 |
| Coordinates | 44752..45120 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA22_RS00200 (39419) | 39419..39712 | - | 294 | WP_001297978.1 | protein YicS | - |
| QQA22_RS00205 (39934) | 39934..40752 | + | 819 | WP_000779405.1 | lipoprotein NlpA | - |
| QQA22_RS00210 (40756) | 40756..41679 | - | 924 | WP_000535959.1 | carboxylate/amino acid/amine transporter | - |
| QQA22_RS00215 (41846) | 41846..42343 | - | 498 | WP_000509808.1 | hypothetical protein | - |
| QQA22_RS00220 (42939) | 42939..43781 | - | 843 | WP_001696593.1 | DUF4942 domain-containing protein | - |
| QQA22_RS00225 (43866) | 43866..44063 | - | 198 | WP_086795284.1 | DUF957 domain-containing protein | - |
| QQA22_RS00230 (44139) | 44139..44288 | - | 150 | Protein_45 | DUF5983 family protein | - |
| QQA22_RS00235 (44285) | 44285..44662 | - | 378 | WP_000854694.1 | TA system toxin CbtA family protein | Toxin |
| QQA22_RS00240 (44752) | 44752..45120 | - | 369 | WP_065793167.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA22_RS00245 (45283) | 45283..45504 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
| QQA22_RS00250 (45567) | 45567..46043 | - | 477 | WP_001186710.1 | RadC family protein | - |
| QQA22_RS00255 (46055) | 46055..46534 | - | 480 | WP_000860065.1 | antirestriction protein | - |
| QQA22_RS00260 (46616) | 46616..47434 | - | 819 | WP_001175149.1 | DUF932 domain-containing protein | - |
| QQA22_RS00265 (47524) | 47524..47757 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QQA22_RS00270 (47763) | 47763..48440 | - | 678 | WP_001097305.1 | hypothetical protein | - |
| QQA22_RS00275 (48588) | 48588..49268 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14008.02 Da Isoelectric Point: 7.7293
>T283333 WP_000854694.1 NZ_CP126952:c44662-44285 [Escherichia coli O78:H4]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.50 Da Isoelectric Point: 6.6249
>AT283333 WP_065793167.1 NZ_CP126952:c45120-44752 [Escherichia coli O78:H4]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYMAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|