Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4514403..4515235 | Replicon | chromosome |
| Accession | NZ_CP126948 | ||
| Organism | Escherichia coli O78:H4 strain APEC E14033 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | QQA23_RS22100 | Protein ID | WP_000854753.1 |
| Coordinates | 4514861..4515235 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QQA23_RS22095 | Protein ID | WP_289245545.1 |
| Coordinates | 4514403..4514771 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA23_RS22060 (4510294) | 4510294..4510974 | + | 681 | WP_001593697.1 | WYL domain-containing protein | - |
| QQA23_RS22065 (4511122) | 4511122..4511799 | + | 678 | WP_097742020.1 | hypothetical protein | - |
| QQA23_RS22070 (4511805) | 4511805..4512038 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| QQA23_RS22075 (4512128) | 4512128..4512946 | + | 819 | WP_001175169.1 | DUF932 domain-containing protein | - |
| QQA23_RS22080 (4513038) | 4513038..4513523 | + | 486 | WP_000206658.1 | antirestriction protein | - |
| QQA23_RS22085 (4513539) | 4513539..4514015 | + | 477 | WP_001367707.1 | RadC family protein | - |
| QQA23_RS22090 (4514102) | 4514102..4514323 | + | 222 | WP_000691819.1 | DUF987 domain-containing protein | - |
| QQA23_RS22095 (4514403) | 4514403..4514771 | + | 369 | WP_289245545.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA23_RS22100 (4514861) | 4514861..4515235 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| QQA23_RS22105 (4515232) | 4515232..4515720 | + | 489 | WP_000777541.1 | DUF5983 family protein | - |
| QQA23_RS22110 (4515732) | 4515732..4515929 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| QQA23_RS22115 (4516026) | 4516026..4516595 | + | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
| QQA23_RS22120 (4517344) | 4517344..4518882 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | ant(3'')-Ia / qacE / sul1 | sfaX / papF / papE / papK / papJ / papD / papC / papH / papB / papI | 4446890..4526695 | 79805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T283324 WP_000854753.1 NZ_CP126948:4514861-4515235 [Escherichia coli O78:H4]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13483.25 Da Isoelectric Point: 6.4782
>AT283324 WP_289245545.1 NZ_CP126948:4514403-4514771 [Escherichia coli O78:H4]
VSDTLPGTTHPDDNNDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLPGTTHPDDNNDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|