Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3960426..3961224 Replicon chromosome
Accession NZ_CP126948
Organism Escherichia coli O78:H4 strain APEC E14033

Toxin (Protein)


Gene name yeeV Uniprot ID Q8VRA6
Locus tag QQA23_RS19385 Protein ID WP_000854730.1
Coordinates 3960847..3961224 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P0SQV8
Locus tag QQA23_RS19380 Protein ID WP_001285481.1
Coordinates 3960426..3960800 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA23_RS19340 (3956401) 3956401..3956853 + 453 WP_000682723.1 hypothetical protein -
QQA23_RS19345 (3956971) 3956971..3957204 + 234 WP_001213776.1 DUF905 family protein -
QQA23_RS19350 (3957304) 3957304..3958125 + 822 WP_001234359.1 DUF932 domain-containing protein -
QQA23_RS19355 (3958125) 3958125..3958370 + 246 WP_001164966.1 hypothetical protein -
QQA23_RS19360 (3958464) 3958464..3958937 + 474 WP_064262004.1 antirestriction protein -
QQA23_RS19365 (3958953) 3958953..3959429 + 477 WP_044502179.1 RadC family protein -
QQA23_RS19370 (3959492) 3959492..3959713 + 222 WP_000692315.1 DUF987 domain-containing protein -
QQA23_RS19375 (3959732) 3959732..3960376 + 645 WP_059338692.1 hypothetical protein -
QQA23_RS19380 (3960426) 3960426..3960800 + 375 WP_001285481.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQA23_RS19385 (3960847) 3960847..3961224 + 378 WP_000854730.1 TA system toxin CbtA family protein Toxin
QQA23_RS19390 (3961221) 3961221..3961713 + 493 Protein_3801 DUF5983 family protein -
QQA23_RS19395 (3961792) 3961792..3962780 - 989 Protein_3802 IS630 family transposase -
QQA23_RS19400 (3962928) 3962928..3964521 - 1594 Protein_3803 IS66 family transposase -
QQA23_RS19405 (3964552) 3964552..3964902 - 351 WP_000624707.1 IS66 family insertion sequence element accessory protein TnpB -
QQA23_RS19410 (3964899) 3964899..3965190 - 292 Protein_3805 transposase -
QQA23_RS19415 (3965232) 3965232..3965426 + 195 WP_001313570.1 DUF957 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14212.21 Da        Isoelectric Point: 7.2923

>T283323 WP_000854730.1 NZ_CP126948:3960847-3961224 [Escherichia coli O78:H4]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13817.53 Da        Isoelectric Point: 4.7511

>AT283323 WP_001285481.1 NZ_CP126948:3960426-3960800 [Escherichia coli O78:H4]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V671

Antitoxin

Source ID Structure
AlphaFold DB A0A0P0SQV8

References