Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3619656..3620274 | Replicon | chromosome |
Accession | NZ_CP126948 | ||
Organism | Escherichia coli O78:H4 strain APEC E14033 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQA23_RS17865 | Protein ID | WP_001291435.1 |
Coordinates | 3620056..3620274 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQA23_RS17860 | Protein ID | WP_000344800.1 |
Coordinates | 3619656..3620030 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA23_RS17850 (3614745) | 3614745..3615938 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QQA23_RS17855 (3615961) | 3615961..3619110 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQA23_RS17860 (3619656) | 3619656..3620030 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQA23_RS17865 (3620056) | 3620056..3620274 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQA23_RS17870 (3620446) | 3620446..3620997 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QQA23_RS17875 (3621113) | 3621113..3621583 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QQA23_RS17880 (3621747) | 3621747..3623297 | + | 1551 | WP_001317659.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQA23_RS17885 (3623339) | 3623339..3623692 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QQA23_RS17895 (3624071) | 3624071..3624382 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QQA23_RS17900 (3624413) | 3624413..3624985 | - | 573 | WP_000779821.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283322 WP_001291435.1 NZ_CP126948:3620056-3620274 [Escherichia coli O78:H4]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283322 WP_000344800.1 NZ_CP126948:3619656-3620030 [Escherichia coli O78:H4]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |