Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2953501..2954285 | Replicon | chromosome |
Accession | NZ_CP126948 | ||
Organism | Escherichia coli O78:H4 strain APEC E14033 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QQA23_RS14480 | Protein ID | WP_000613624.1 |
Coordinates | 2953791..2954285 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B1LI61 |
Locus tag | QQA23_RS14475 | Protein ID | WP_001110446.1 |
Coordinates | 2953501..2953794 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA23_RS14465 (2948650) | 2948650..2949609 | - | 960 | WP_000846329.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
QQA23_RS14470 (2950182) | 2950182..2953367 | + | 3186 | WP_000827395.1 | ribonuclease E | - |
QQA23_RS14475 (2953501) | 2953501..2953794 | + | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
QQA23_RS14480 (2953791) | 2953791..2954285 | + | 495 | WP_000613624.1 | GNAT family N-acetyltransferase | Toxin |
QQA23_RS14485 (2954380) | 2954380..2955333 | - | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
QQA23_RS14490 (2955345) | 2955345..2956988 | - | 1644 | WP_000096482.1 | flagellar hook-associated protein FlgK | - |
QQA23_RS14495 (2957054) | 2957054..2957995 | - | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
QQA23_RS14500 (2957995) | 2957995..2959092 | - | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18142.04 Da Isoelectric Point: 7.7444
>T283319 WP_000613624.1 NZ_CP126948:2953791-2954285 [Escherichia coli O78:H4]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|