Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2581222..2581858 | Replicon | chromosome |
| Accession | NZ_CP126948 | ||
| Organism | Escherichia coli O78:H4 strain APEC E14033 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A5F1EUB3 |
| Locus tag | QQA23_RS12550 | Protein ID | WP_000813796.1 |
| Coordinates | 2581682..2581858 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QQA23_RS12545 | Protein ID | WP_076838470.1 |
| Coordinates | 2581222..2581638 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA23_RS12525 (2576374) | 2576374..2577315 | - | 942 | WP_001251307.1 | ABC transporter permease | - |
| QQA23_RS12530 (2577316) | 2577316..2578329 | - | 1014 | WP_000220433.1 | ABC transporter ATP-binding protein | - |
| QQA23_RS12535 (2578347) | 2578347..2579492 | - | 1146 | WP_000047448.1 | ABC transporter substrate-binding protein | - |
| QQA23_RS12540 (2579737) | 2579737..2581143 | - | 1407 | WP_000760605.1 | PLP-dependent aminotransferase family protein | - |
| QQA23_RS12545 (2581222) | 2581222..2581638 | - | 417 | WP_076838470.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QQA23_RS12550 (2581682) | 2581682..2581858 | - | 177 | WP_000813796.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QQA23_RS12555 (2582080) | 2582080..2582310 | + | 231 | WP_000494243.1 | YncJ family protein | - |
| QQA23_RS12560 (2582402) | 2582402..2584363 | - | 1962 | WP_001317809.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QQA23_RS12565 (2584436) | 2584436..2584972 | - | 537 | WP_000429147.1 | DNA-binding transcriptional regulator SutR | - |
| QQA23_RS12570 (2585064) | 2585064..2586236 | + | 1173 | WP_001236216.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T283318 WP_000813796.1 NZ_CP126948:c2581858-2581682 [Escherichia coli O78:H4]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15219.59 Da Isoelectric Point: 4.5908
>AT283318 WP_076838470.1 NZ_CP126948:c2581638-2581222 [Escherichia coli O78:H4]
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|