Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1391685..1392310 | Replicon | chromosome |
| Accession | NZ_CP126948 | ||
| Organism | Escherichia coli O78:H4 strain APEC E14033 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | QQA23_RS06675 | Protein ID | WP_000911329.1 |
| Coordinates | 1391912..1392310 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | QQA23_RS06670 | Protein ID | WP_000450524.1 |
| Coordinates | 1391685..1391912 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA23_RS06645 (1387485) | 1387485..1387955 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| QQA23_RS06650 (1387955) | 1387955..1388527 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| QQA23_RS06655 (1388673) | 1388673..1389551 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| QQA23_RS06660 (1389568) | 1389568..1390602 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| QQA23_RS06665 (1390815) | 1390815..1391528 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| QQA23_RS06670 (1391685) | 1391685..1391912 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QQA23_RS06675 (1391912) | 1391912..1392310 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQA23_RS06680 (1392457) | 1392457..1393320 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| QQA23_RS06685 (1393335) | 1393335..1395350 | + | 2016 | WP_000829310.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| QQA23_RS06690 (1395424) | 1395424..1396122 | + | 699 | WP_000679819.1 | esterase | - |
| QQA23_RS06695 (1396203) | 1396203..1396403 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T283310 WP_000911329.1 NZ_CP126948:1391912-1392310 [Escherichia coli O78:H4]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |