Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 957103..957757 | Replicon | chromosome |
Accession | NZ_CP126948 | ||
Organism | Escherichia coli O78:H4 strain APEC E14033 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QQA23_RS04705 | Protein ID | WP_000244781.1 |
Coordinates | 957350..957757 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QQA23_RS04700 | Protein ID | WP_000354046.1 |
Coordinates | 957103..957369 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA23_RS04680 (953181) | 953181..954614 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
QQA23_RS04685 (954659) | 954659..954970 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
QQA23_RS04690 (955134) | 955134..955793 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
QQA23_RS04695 (955870) | 955870..956850 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
QQA23_RS04700 (957103) | 957103..957369 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QQA23_RS04705 (957350) | 957350..957757 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QQA23_RS04710 (957797) | 957797..958318 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QQA23_RS04715 (958430) | 958430..959326 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QQA23_RS04720 (959351) | 959351..960061 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QQA23_RS04725 (960067) | 960067..961800 | + | 1734 | WP_000813191.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283309 WP_000244781.1 NZ_CP126948:957350-957757 [Escherichia coli O78:H4]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|