Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 792312..793144 Replicon chromosome
Accession NZ_CP126948
Organism Escherichia coli O78:H4 strain APEC E14033

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag QQA23_RS03880 Protein ID WP_000854753.1
Coordinates 792312..792686 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID E3PJ72
Locus tag QQA23_RS03885 Protein ID WP_001278232.1
Coordinates 792776..793144 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA23_RS03845 (787380) 787380..787985 + 606 WP_001318033.1 type II secretion system minor pseudopilin GspJ -
QQA23_RS03850 (787982) 787982..788959 + 978 WP_000633196.1 type II secretion system minor pseudopilin GspK -
QQA23_RS03855 (788956) 788956..790134 + 1179 WP_000097200.1 type II secretion system protein GspL -
QQA23_RS03860 (790136) 790136..790672 + 537 WP_000942807.1 GspM family type II secretion system protein YghD -
QQA23_RS03865 (790952) 790952..791521 - 570 WP_001290247.1 DUF4942 domain-containing protein -
QQA23_RS03870 (791618) 791618..791815 - 198 WP_000839281.1 DUF957 domain-containing protein -
QQA23_RS03875 (791827) 791827..792315 - 489 WP_000777541.1 DUF5983 family protein -
QQA23_RS03880 (792312) 792312..792686 - 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
QQA23_RS03885 (792776) 792776..793144 - 369 WP_001278232.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA23_RS03890 (793307) 793307..793528 - 222 WP_000692303.1 DUF987 domain-containing protein -
QQA23_RS03895 (793591) 793591..794067 - 477 WP_001186710.1 RadC family protein -
QQA23_RS03900 (794079) 794079..794558 - 480 WP_000860065.1 antirestriction protein -
QQA23_RS03905 (794640) 794640..795458 - 819 WP_001234631.1 DUF932 domain-containing protein -
QQA23_RS03910 (795557) 795557..795790 - 234 WP_001278287.1 DUF905 family protein -
QQA23_RS03915 (795796) 795796..796473 - 678 WP_001097305.1 hypothetical protein -
QQA23_RS03920 (796621) 796621..797301 - 681 WP_001593697.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T283308 WP_000854753.1 NZ_CP126948:c792686-792312 [Escherichia coli O78:H4]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13491.37 Da        Isoelectric Point: 6.6290

>AT283308 WP_001278232.1 NZ_CP126948:c793144-792776 [Escherichia coli O78:H4]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB E3PJ72

References