Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 293732..294327 | Replicon | chromosome |
| Accession | NZ_CP126948 | ||
| Organism | Escherichia coli O78:H4 strain APEC E14033 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | D6JG31 |
| Locus tag | QQA23_RS01370 | Protein ID | WP_000155159.1 |
| Coordinates | 293950..294327 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | D6JG32 |
| Locus tag | QQA23_RS01365 | Protein ID | WP_000557315.1 |
| Coordinates | 293732..293953 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA23_RS01340 (288808) | 288808..289917 | + | 1110 | WP_001318085.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| QQA23_RS01345 (289965) | 289965..290891 | + | 927 | WP_000003010.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QQA23_RS01350 (290888) | 290888..292165 | + | 1278 | WP_000803825.1 | branched chain amino acid ABC transporter permease LivM | - |
| QQA23_RS01355 (292162) | 292162..292929 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QQA23_RS01360 (292931) | 292931..293644 | + | 714 | WP_000416895.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| QQA23_RS01365 (293732) | 293732..293953 | + | 222 | WP_000557315.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQA23_RS01370 (293950) | 293950..294327 | + | 378 | WP_000155159.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QQA23_RS01375 (294536) | 294536..295852 | + | 1317 | WP_000803191.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| QQA23_RS01380 (296028) | 296028..296915 | + | 888 | WP_000099289.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| QQA23_RS01385 (296912) | 296912..297757 | + | 846 | WP_000572164.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| QQA23_RS01390 (297759) | 297759..298829 | + | 1071 | WP_000907828.1 | sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 290888..299569 | 8681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13964.25 Da Isoelectric Point: 6.7263
>T283306 WP_000155159.1 NZ_CP126948:293950-294327 [Escherichia coli O78:H4]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|