Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 293732..294327 Replicon chromosome
Accession NZ_CP126948
Organism Escherichia coli O78:H4 strain APEC E14033

Toxin (Protein)


Gene name doc Uniprot ID D6JG31
Locus tag QQA23_RS01370 Protein ID WP_000155159.1
Coordinates 293950..294327 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag QQA23_RS01365 Protein ID WP_000557315.1
Coordinates 293732..293953 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA23_RS01340 (288808) 288808..289917 + 1110 WP_001318085.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QQA23_RS01345 (289965) 289965..290891 + 927 WP_000003010.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QQA23_RS01350 (290888) 290888..292165 + 1278 WP_000803825.1 branched chain amino acid ABC transporter permease LivM -
QQA23_RS01355 (292162) 292162..292929 + 768 WP_000082101.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QQA23_RS01360 (292931) 292931..293644 + 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QQA23_RS01365 (293732) 293732..293953 + 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQA23_RS01370 (293950) 293950..294327 + 378 WP_000155159.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QQA23_RS01375 (294536) 294536..295852 + 1317 WP_000803191.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QQA23_RS01380 (296028) 296028..296915 + 888 WP_000099289.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QQA23_RS01385 (296912) 296912..297757 + 846 WP_000572164.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QQA23_RS01390 (297759) 297759..298829 + 1071 WP_000907828.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 290888..299569 8681


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(27-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13964.25 Da        Isoelectric Point: 6.7263

>T283306 WP_000155159.1 NZ_CP126948:293950-294327 [Escherichia coli O78:H4]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT283306 WP_000557315.1 NZ_CP126948:293732-293953 [Escherichia coli O78:H4]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D6JG31

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References