Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 266456..267087 | Replicon | chromosome |
Accession | NZ_CP126948 | ||
Organism | Escherichia coli O78:H4 strain APEC E14033 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | L4J012 |
Locus tag | QQA23_RS01215 | Protein ID | WP_001260301.1 |
Coordinates | 266456..266731 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IZA1 |
Locus tag | QQA23_RS01220 | Protein ID | WP_000593557.1 |
Coordinates | 266728..267087 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA23_RS01200 (261460) | 261460..262527 | + | 1068 | WP_000361470.1 | HlyD family secretion protein | - |
QQA23_RS01205 (262524) | 262524..265259 | + | 2736 | WP_000149178.1 | ribosome-associated ATPase/putative transporter RbbA | - |
QQA23_RS01210 (265259) | 265259..266383 | + | 1125 | WP_001318088.1 | ABC transporter permease | - |
QQA23_RS01215 (266456) | 266456..266731 | + | 276 | WP_001260301.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QQA23_RS01220 (266728) | 266728..267087 | + | 360 | WP_000593557.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QQA23_RS01225 (267207) | 267207..267608 | - | 402 | WP_001190062.1 | nickel-responsive transcriptional regulator NikR | - |
QQA23_RS01230 (267614) | 267614..268420 | - | 807 | WP_000173650.1 | nickel import ATP-binding protein NikE | - |
QQA23_RS01235 (268417) | 268417..269181 | - | 765 | WP_001136206.1 | nickel import ATP-binding protein NikD | - |
QQA23_RS01240 (269181) | 269181..270014 | - | 834 | WP_001008963.1 | nickel ABC transporter permease subunit NikC | - |
QQA23_RS01245 (270011) | 270011..270955 | - | 945 | WP_000947063.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10185.87 Da Isoelectric Point: 10.6128
>T283305 WP_001260301.1 NZ_CP126948:266456-266731 [Escherichia coli O78:H4]
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
MRTQVQALRKKQKNTLDQIFKSPVPQGIKWSDIESLVKALGGEIKEGRGSRCKFILNMSVACFHRPHPSPDTDKGAVESV
RDWLLSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13389.28 Da Isoelectric Point: 5.1987
>AT283305 WP_000593557.1 NZ_CP126948:266728-267087 [Escherichia coli O78:H4]
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLTNAAAQQQVSVNTYIIETLNERLNHL
MIKLKTPNSMEIAGQPAVITYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGELSLREYLEDCKAAGIEPYARTEKIKT
FTLRYPESLSERLTNAAAQQQVSVNTYIIETLNERLNHL
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|