Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 124165..124790 Replicon plasmid pEND_Eco 18005
Accession NZ_CP126947
Organism Escherichia coli O78:H51 strain APEC E18005

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QQA24_RS25515 Protein ID WP_000911333.1
Coordinates 124392..124790 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID V0VCB2
Locus tag QQA24_RS25510 Protein ID WP_000450520.1
Coordinates 124165..124392 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA24_RS25495 (121128) 121128..121475 + 348 Protein_119 WbuC family cupin fold metalloprotein -
QQA24_RS25500 (121522) 121522..122397 - 876 WP_013188473.1 extended-spectrum class A beta-lactamase CTX-M-1 -
QQA24_RS25505 (122685) 122685..123947 - 1263 WP_000608644.1 IS1380-like element ISEcp1 family transposase -
QQA24_RS25510 (124165) 124165..124392 + 228 WP_000450520.1 toxin-antitoxin system antitoxin VapB Antitoxin
QQA24_RS25515 (124392) 124392..124790 + 399 WP_000911333.1 tRNA(fMet)-specific endonuclease VapC Toxin
QQA24_RS25520 (124799) 124799..126952 - 2154 Protein_124 type IV conjugative transfer system coupling protein TraD -
QQA24_RS25525 (127205) 127205..127936 - 732 WP_000850422.1 conjugal transfer complement resistance protein TraT -
QQA24_RS25530 (127950) 127950..128459 - 510 WP_021525551.1 conjugal transfer entry exclusion protein TraS -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / blaCTX-M-1 iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..204838 204838
- flank IS/Tn blaCTX-M-1 - 121522..123947 2425


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(8-50)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14919.19 Da        Isoelectric Point: 7.8605

>T283298 WP_000911333.1 NZ_CP126947:124392-124790 [Escherichia coli O78:H51]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8596.63 Da        Isoelectric Point: 4.7513

>AT283298 WP_000450520.1 NZ_CP126947:124165-124392 [Escherichia coli O78:H51]
METTVFFSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAGETWDEWFDGHNVSADFMDNREQPGMQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB V0VCB2

References