Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 104591..105126 Replicon plasmid pEND_Eco 18005
Accession NZ_CP126947
Organism Escherichia coli O78:H51 strain APEC E18005

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag QQA24_RS25400 Protein ID WP_000222766.1
Coordinates 104591..104878 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag QQA24_RS25405 Protein ID WP_001132900.1
Coordinates 104875..105126 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA24_RS25385 (102710) 102710..102904 + 195 Protein_97 IS91 family transposase -
QQA24_RS25390 (102875) 102875..103042 - 168 Protein_98 helix-turn-helix transcriptional regulator -
QQA24_RS25395 (103109) 103109..104322 + 1214 WP_289257140.1 IS3 family transposase -
QQA24_RS25400 (104591) 104591..104878 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QQA24_RS25405 (104875) 104875..105126 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQA24_RS25410 (106088) 106088..106486 - 399 Protein_102 plasmid replication initiator RepA -
QQA24_RS25415 (106517) 106517..108088 - 1572 WP_289257139.1 IS66 family transposase -
QQA24_RS25420 (108108) 108108..108455 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
QQA24_RS25425 (108455) 108455..109132 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
QQA24_RS25430 (109185) 109185..109652 - 468 Protein_106 plasmid replication initiator RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / blaCTX-M-1 iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..204838 204838
- inside IScluster/Tn - - 103109..112265 9156


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T283296 WP_000222766.1 NZ_CP126947:c104878-104591 [Escherichia coli O78:H51]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT283296 WP_001132900.1 NZ_CP126947:c105126-104875 [Escherichia coli O78:H51]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References