Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 91907..92550 Replicon plasmid pEND_Eco 18005
Accession NZ_CP126947
Organism Escherichia coli O78:H51 strain APEC E18005

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QQA24_RS25345 Protein ID WP_001034044.1
Coordinates 92134..92550 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QQA24_RS25340 Protein ID WP_001261286.1
Coordinates 91907..92137 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA24_RS25305 (87080) 87080..87247 + 168 Protein_81 colicin-B -
QQA24_RS25310 (87265) 87265..87792 - 528 WP_000203272.1 colicin B immunity protein -
QQA24_RS25315 (88036) 88036..88851 + 816 WP_001312845.1 lipid II-degrading bacteriocin colicin M -
QQA24_RS25320 (88901) 88901..89254 - 354 WP_000864812.1 colicin M immunity protein -
QQA24_RS25325 (89432) 89432..90223 - 792 WP_000016494.1 site-specific integrase -
QQA24_RS25330 (90220) 90220..90909 - 690 WP_000796228.1 hypothetical protein -
QQA24_RS25335 (90953) 90953..91303 - 351 WP_000493379.1 hypothetical protein -
QQA24_RS25340 (91907) 91907..92137 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA24_RS25345 (92134) 92134..92550 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA24_RS25350 (92625) 92625..94190 + 1566 WP_001128474.1 AAA family ATPase -
QQA24_RS25355 (94175) 94175..95197 + 1023 WP_000361402.1 helicase UvrD -
QQA24_RS25360 (95222) 95222..95449 - 228 Protein_92 IS1 family transposase -
QQA24_RS25365 (95648) 95648..97189 + 1542 WP_039023592.1 IS21-like element ISEc12 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / blaCTX-M-1 iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..204838 204838


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T283295 WP_001034044.1 NZ_CP126947:92134-92550 [Escherichia coli O78:H51]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT283295 WP_001261286.1 NZ_CP126947:91907-92137 [Escherichia coli O78:H51]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References