Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4651271..4652105 | Replicon | chromosome |
| Accession | NZ_CP126946 | ||
| Organism | Escherichia coli O78:H51 strain APEC E18005 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QQA24_RS22585 | Protein ID | WP_001518317.1 |
| Coordinates | 4651728..4652105 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QQA24_RS22580 | Protein ID | WP_024187829.1 |
| Coordinates | 4651271..4651639 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA24_RS22545 (4647911) | 4647911..4648366 | + | 456 | WP_001518314.1 | IrmA family protein | - |
| QQA24_RS22550 (4648509) | 4648509..4648598 | + | 90 | WP_112031555.1 | DUF905 family protein | - |
| QQA24_RS22555 (4648777) | 4648777..4649598 | + | 822 | WP_001518315.1 | DUF932 domain-containing protein | - |
| QQA24_RS22560 (4649598) | 4649598..4649843 | + | 246 | WP_001518015.1 | hypothetical protein | - |
| QQA24_RS22565 (4649937) | 4649937..4650410 | + | 474 | WP_001518016.1 | antirestriction protein | - |
| QQA24_RS22570 (4650426) | 4650426..4650902 | + | 477 | WP_136675763.1 | RadC family protein | - |
| QQA24_RS22575 (4650971) | 4650971..4651192 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QQA24_RS22580 (4651271) | 4651271..4651639 | + | 369 | WP_024187829.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA24_RS22585 (4651728) | 4651728..4652105 | + | 378 | WP_001518317.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQA24_RS22590 (4652102) | 4652102..4652590 | + | 489 | WP_001518318.1 | DUF5983 family protein | - |
| QQA24_RS22595 (4652602) | 4652602..4652799 | + | 198 | WP_000839251.1 | DUF957 domain-containing protein | - |
| QQA24_RS22600 (4652884) | 4652884..4653729 | + | 846 | WP_001518322.1 | DUF4942 domain-containing protein | - |
| QQA24_RS22605 (4653964) | 4653964..4654125 | + | 162 | Protein_4428 | RhuM family protein | - |
| QQA24_RS22610 (4654522) | 4654522..4655706 | + | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| QQA24_RS22615 (4655817) | 4655817..4656740 | + | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13964.02 Da Isoelectric Point: 8.9341
>T283291 WP_001518317.1 NZ_CP126946:4651728-4652105 [Escherichia coli O78:H51]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKYPEAKR
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKYPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13631.41 Da Isoelectric Point: 6.2044
>AT283291 WP_024187829.1 NZ_CP126946:4651271-4651639 [Escherichia coli O78:H51]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|