Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3838759..3839594 | Replicon | chromosome |
| Accession | NZ_CP126946 | ||
| Organism | Escherichia coli O78:H51 strain APEC E18005 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | QQA24_RS18675 | Protein ID | WP_000854821.1 |
| Coordinates | 3839217..3839594 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QQA24_RS18670 | Protein ID | WP_032216526.1 |
| Coordinates | 3838759..3839127 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA24_RS18630 (3833891) | 3833891..3834775 | + | 885 | WP_000010399.1 | 50S ribosome-binding GTPase | - |
| QQA24_RS18635 (3834894) | 3834894..3835571 | + | 678 | WP_001097362.1 | hypothetical protein | - |
| QQA24_RS18640 (3835577) | 3835577..3835810 | + | 234 | WP_001278288.1 | DUF905 family protein | - |
| QQA24_RS18645 (3835900) | 3835900..3836718 | + | 819 | WP_165473672.1 | DUF932 domain-containing protein | - |
| QQA24_RS18650 (3836810) | 3836810..3837295 | + | 486 | WP_032216512.1 | antirestriction protein | - |
| QQA24_RS18655 (3837311) | 3837311..3837787 | + | 477 | WP_001186724.1 | RadC family protein | - |
| QQA24_RS18660 (3837856) | 3837856..3838077 | + | 222 | WP_001601167.1 | DUF987 domain-containing protein | - |
| QQA24_RS18665 (3838096) | 3838096..3838740 | + | 645 | Protein_3652 | antitoxin of toxin-antitoxin stability system | - |
| QQA24_RS18670 (3838759) | 3838759..3839127 | + | 369 | WP_032216526.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA24_RS18675 (3839217) | 3839217..3839594 | + | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQA24_RS18680 (3839591) | 3839591..3839740 | + | 150 | Protein_3655 | DUF5983 family protein | - |
| QQA24_RS18685 (3839816) | 3839816..3840013 | + | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| QQA24_RS18690 (3840098) | 3840098..3840940 | + | 843 | WP_001280501.1 | DUF4942 domain-containing protein | - |
| QQA24_RS18695 (3841221) | 3841221..3841757 | - | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| QQA24_RS18700 (3841759) | 3841759..3842937 | - | 1179 | WP_000094989.1 | type II secretion system protein GspL | - |
| QQA24_RS18705 (3842934) | 3842934..3843911 | - | 978 | WP_000633239.1 | type II secretion system minor pseudopilin GspK | - |
| QQA24_RS18710 (3843908) | 3843908..3844513 | - | 606 | WP_001255030.1 | type II secretion system minor pseudopilin GspJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papC / papD / gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspF / gspE / gspD / gspC | 3779176..3903311 | 124135 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T283287 WP_000854821.1 NZ_CP126946:3839217-3839594 [Escherichia coli O78:H51]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13810.69 Da Isoelectric Point: 6.2066
>AT283287 WP_032216526.1 NZ_CP126946:3838759-3839127 [Escherichia coli O78:H51]
VSDKLHETNYPDDHNDRLWWGLLCTVTPCFGARLVQEGNRLHYLVDRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLHETNYPDDHNDRLWWGLLCTVTPCFGARLVQEGNRLHYLVDRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|