Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3838759..3839594 Replicon chromosome
Accession NZ_CP126946
Organism Escherichia coli O78:H51 strain APEC E18005

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QQA24_RS18675 Protein ID WP_000854821.1
Coordinates 3839217..3839594 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QQA24_RS18670 Protein ID WP_032216526.1
Coordinates 3838759..3839127 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA24_RS18630 (3833891) 3833891..3834775 + 885 WP_000010399.1 50S ribosome-binding GTPase -
QQA24_RS18635 (3834894) 3834894..3835571 + 678 WP_001097362.1 hypothetical protein -
QQA24_RS18640 (3835577) 3835577..3835810 + 234 WP_001278288.1 DUF905 family protein -
QQA24_RS18645 (3835900) 3835900..3836718 + 819 WP_165473672.1 DUF932 domain-containing protein -
QQA24_RS18650 (3836810) 3836810..3837295 + 486 WP_032216512.1 antirestriction protein -
QQA24_RS18655 (3837311) 3837311..3837787 + 477 WP_001186724.1 RadC family protein -
QQA24_RS18660 (3837856) 3837856..3838077 + 222 WP_001601167.1 DUF987 domain-containing protein -
QQA24_RS18665 (3838096) 3838096..3838740 + 645 Protein_3652 antitoxin of toxin-antitoxin stability system -
QQA24_RS18670 (3838759) 3838759..3839127 + 369 WP_032216526.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQA24_RS18675 (3839217) 3839217..3839594 + 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA24_RS18680 (3839591) 3839591..3839740 + 150 Protein_3655 DUF5983 family protein -
QQA24_RS18685 (3839816) 3839816..3840013 + 198 WP_023563519.1 DUF957 domain-containing protein -
QQA24_RS18690 (3840098) 3840098..3840940 + 843 WP_001280501.1 DUF4942 domain-containing protein -
QQA24_RS18695 (3841221) 3841221..3841757 - 537 WP_000942795.1 GspM family type II secretion system protein YghD -
QQA24_RS18700 (3841759) 3841759..3842937 - 1179 WP_000094989.1 type II secretion system protein GspL -
QQA24_RS18705 (3842934) 3842934..3843911 - 978 WP_000633239.1 type II secretion system minor pseudopilin GspK -
QQA24_RS18710 (3843908) 3843908..3844513 - 606 WP_001255030.1 type II secretion system minor pseudopilin GspJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papC / papD / gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspF / gspE / gspD / gspC 3779176..3903311 124135


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T283287 WP_000854821.1 NZ_CP126946:3839217-3839594 [Escherichia coli O78:H51]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13810.69 Da        Isoelectric Point: 6.2066

>AT283287 WP_032216526.1 NZ_CP126946:3838759-3839127 [Escherichia coli O78:H51]
VSDKLHETNYPDDHNDRLWWGLLCTVTPCFGARLVQEGNRLHYLVDRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References