Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3263976..3264601 | Replicon | chromosome |
| Accession | NZ_CP126946 | ||
| Organism | Escherichia coli O78:H51 strain APEC E18005 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQA24_RS15860 | Protein ID | WP_000911330.1 |
| Coordinates | 3263976..3264374 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | QQA24_RS15865 | Protein ID | WP_000450524.1 |
| Coordinates | 3264374..3264601 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA24_RS15840 (3259854) | 3259854..3260054 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| QQA24_RS15845 (3260164) | 3260164..3260862 | - | 699 | WP_000679823.1 | esterase | - |
| QQA24_RS15850 (3260936) | 3260936..3262951 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| QQA24_RS15855 (3262966) | 3262966..3263829 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| QQA24_RS15860 (3263976) | 3263976..3264374 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQA24_RS15865 (3264374) | 3264374..3264601 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QQA24_RS15870 (3264755) | 3264755..3265468 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| QQA24_RS15875 (3265681) | 3265681..3266715 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| QQA24_RS15880 (3266732) | 3266732..3267610 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| QQA24_RS15885 (3267756) | 3267756..3268328 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| QQA24_RS15890 (3268328) | 3268328..3268798 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T283284 WP_000911330.1 NZ_CP126946:c3264374-3263976 [Escherichia coli O78:H51]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|