Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2725693..2726524 Replicon chromosome
Accession NZ_CP126946
Organism Escherichia coli O78:H51 strain APEC E18005

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQA24_RS13365 Protein ID WP_000854814.1
Coordinates 2726150..2726524 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEU4
Locus tag QQA24_RS13360 Protein ID WP_001285591.1
Coordinates 2725693..2726061 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA24_RS13325 (2722049) 2722049..2722396 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
QQA24_RS13330 (2722396) 2722396..2723073 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
QQA24_RS13335 (2723131) 2723131..2723364 + 234 WP_001119729.1 DUF905 family protein -
QQA24_RS13340 (2723464) 2723464..2724282 + 819 WP_001234629.1 DUF932 domain-containing protein -
QQA24_RS13345 (2724364) 2724364..2724843 + 480 WP_000860087.1 antirestriction protein -
QQA24_RS13350 (2724859) 2724859..2725335 + 477 WP_136762736.1 RadC family protein -
QQA24_RS13355 (2725398) 2725398..2725619 + 222 WP_000692323.1 DUF987 domain-containing protein -
QQA24_RS13360 (2725693) 2725693..2726061 + 369 WP_001285591.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA24_RS13365 (2726150) 2726150..2726524 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA24_RS13370 (2726521) 2726521..2726715 + 195 WP_039023483.1 DUF5983 family protein -
QQA24_RS13375 (2726761) 2726761..2726841 + 81 Protein_2620 hypothetical protein -
QQA24_RS13380 (2727130) 2727130..2727210 - 81 WP_023441679.1 hypothetical protein -
QQA24_RS13385 (2727189) 2727189..2727512 + 324 WP_225343796.1 EutP/PduV family microcompartment system protein -
QQA24_RS13390 (2727613) 2727613..2727942 - 330 WP_000450409.1 DUF496 family protein -
QQA24_RS13395 (2728114) 2728114..2728632 - 519 Protein_2624 hypothetical protein -
QQA24_RS13400 (2728727) 2728727..2729707 - 981 WP_000399648.1 IS110-like element IS621 family transposase -
QQA24_RS13405 (2729900) 2729900..2730451 - 552 Protein_2626 FUSC family protein -
QQA24_RS13410 (2730649) 2730649..2731122 - 474 WP_024222062.1 DNA gyrase inhibitor SbmC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2723464..2731768 8304


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T283282 WP_000854814.1 NZ_CP126946:2726150-2726524 [Escherichia coli O78:H51]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13650.54 Da        Isoelectric Point: 6.6249

>AT283282 WP_001285591.1 NZ_CP126946:2725693-2726061 [Escherichia coli O78:H51]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEU4

References