Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2036746..2037384 | Replicon | chromosome |
Accession | NZ_CP126946 | ||
Organism | Escherichia coli O78:H51 strain APEC E18005 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QQA24_RS09935 | Protein ID | WP_000813794.1 |
Coordinates | 2036746..2036922 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QQA24_RS09940 | Protein ID | WP_001270286.1 |
Coordinates | 2036968..2037384 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA24_RS09915 (2032365) | 2032365..2033540 | - | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
QQA24_RS09920 (2033632) | 2033632..2034168 | + | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
QQA24_RS09925 (2034241) | 2034241..2036202 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QQA24_RS09930 (2036294) | 2036294..2036524 | - | 231 | WP_000494244.1 | YncJ family protein | - |
QQA24_RS09935 (2036746) | 2036746..2036922 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QQA24_RS09940 (2036968) | 2036968..2037384 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QQA24_RS09945 (2037463) | 2037463..2038869 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
QQA24_RS09950 (2039114) | 2039114..2040259 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QQA24_RS09955 (2040277) | 2040277..2041290 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QQA24_RS09960 (2041291) | 2041291..2042232 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2031060..2032325 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T283276 WP_000813794.1 NZ_CP126946:2036746-2036922 [Escherichia coli O78:H51]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT283276 WP_001270286.1 NZ_CP126946:2036968-2037384 [Escherichia coli O78:H51]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|