Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1005676..1006294 | Replicon | chromosome |
Accession | NZ_CP126946 | ||
Organism | Escherichia coli O78:H51 strain APEC E18005 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQA24_RS04850 | Protein ID | WP_001291435.1 |
Coordinates | 1005676..1005894 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQA24_RS04855 | Protein ID | WP_000344800.1 |
Coordinates | 1005920..1006294 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA24_RS04815 (1000965) | 1000965..1001537 | + | 573 | WP_289257051.1 | YbaY family lipoprotein | - |
QQA24_RS04820 (1001568) | 1001568..1001879 | - | 312 | WP_000409911.1 | MGMT family protein | - |
QQA24_RS04830 (1002258) | 1002258..1002611 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QQA24_RS04835 (1002653) | 1002653..1004203 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQA24_RS04840 (1004367) | 1004367..1004837 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QQA24_RS04845 (1004953) | 1004953..1005504 | - | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
QQA24_RS04850 (1005676) | 1005676..1005894 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQA24_RS04855 (1005920) | 1005920..1006294 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQA24_RS04860 (1006840) | 1006840..1009989 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQA24_RS04865 (1010012) | 1010012..1011205 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283270 WP_001291435.1 NZ_CP126946:c1005894-1005676 [Escherichia coli O78:H51]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283270 WP_000344800.1 NZ_CP126946:c1006294-1005920 [Escherichia coli O78:H51]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |