Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 971380..972217 | Replicon | chromosome |
Accession | NZ_CP126946 | ||
Organism | Escherichia coli O78:H51 strain APEC E18005 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QQA24_RS04680 | Protein ID | WP_000227784.1 |
Coordinates | 971380..971922 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QQA24_RS04685 | Protein ID | WP_001297137.1 |
Coordinates | 971906..972217 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA24_RS04660 (966919) | 966919..967830 | - | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
QQA24_RS04665 (967998) | 967998..968489 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QQA24_RS04670 (968617) | 968617..969981 | - | 1365 | WP_001000978.1 | MFS transporter | - |
QQA24_RS04675 (970389) | 970389..971324 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QQA24_RS04680 (971380) | 971380..971922 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QQA24_RS04685 (971906) | 971906..972217 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QQA24_RS04690 (972402) | 972402..973292 | - | 891 | WP_000971336.1 | heme o synthase | - |
QQA24_RS04695 (973304) | 973304..973633 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QQA24_RS04700 (973633) | 973633..974247 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QQA24_RS04705 (974237) | 974237..976228 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QQA24_RS04710 (976250) | 976250..977197 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T283269 WP_000227784.1 NZ_CP126946:c971922-971380 [Escherichia coli O78:H51]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|