Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 104210..105079 | Replicon | chromosome |
| Accession | NZ_CP126946 | ||
| Organism | Escherichia coli O78:H51 strain APEC E18005 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M1ISH3 |
| Locus tag | QQA24_RS00505 | Protein ID | WP_039023580.1 |
| Coordinates | 104210..104620 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0X5FMN2 |
| Locus tag | QQA24_RS00510 | Protein ID | WP_039023579.1 |
| Coordinates | 104711..105079 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA24_RS00485 (100805) | 100805..102343 | - | 1539 | WP_001187183.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QQA24_RS00490 (103180) | 103180..103740 | - | 561 | Protein_97 | DUF4942 domain-containing protein | - |
| QQA24_RS00495 (103885) | 103885..104022 | - | 138 | WP_096006700.1 | DUF957 domain-containing protein | - |
| QQA24_RS00500 (104098) | 104098..104247 | - | 150 | Protein_99 | DUF5983 family protein | - |
| QQA24_RS00505 (104210) | 104210..104620 | - | 411 | WP_039023580.1 | TA system toxin CbtA family protein | Toxin |
| QQA24_RS00510 (104711) | 104711..105079 | - | 369 | WP_039023579.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA24_RS00515 (105129) | 105129..105761 | - | 633 | Protein_102 | antitoxin of toxin-antitoxin stability system | - |
| QQA24_RS00520 (105776) | 105776..105997 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| QQA24_RS00525 (106060) | 106060..106536 | - | 477 | WP_001186709.1 | RadC family protein | - |
| QQA24_RS00530 (106548) | 106548..107027 | - | 480 | WP_000860065.1 | antirestriction protein | - |
| QQA24_RS00535 (107109) | 107109..107927 | - | 819 | WP_001234631.1 | DUF932 domain-containing protein | - |
| QQA24_RS00540 (108026) | 108026..108259 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QQA24_RS00545 (108265) | 108265..108942 | - | 678 | WP_001097306.1 | hypothetical protein | - |
| QQA24_RS00550 (109090) | 109090..109770 | - | 681 | WP_001593697.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | tet(B) | - | 93316..152998 | 59682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15253.38 Da Isoelectric Point: 7.2150
>T283266 WP_039023580.1 NZ_CP126946:c104620-104210 [Escherichia coli O78:H51]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQR
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQR
Download Length: 411 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13672.49 Da Isoelectric Point: 6.7393
>AT283266 WP_039023579.1 NZ_CP126946:c105079-104711 [Escherichia coli O78:H51]
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1ISH3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0X5FMN2 |