Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 133861..134396 | Replicon | plasmid pEND_Eco 16002 |
| Accession | NZ_CP126945 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | V0VJJ7 |
| Locus tag | QQA28_RS26165 | Protein ID | WP_000222760.1 |
| Coordinates | 134109..134396 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0VIP2 |
| Locus tag | QQA28_RS26160 | Protein ID | WP_001132900.1 |
| Coordinates | 133861..134112 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS26115 (128988) | 128988..129548 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| QQA28_RS26120 (129684) | 129684..129896 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QQA28_RS26125 (130142) | 130142..130216 | + | 75 | Protein_128 | endonuclease | - |
| - (130472) | 130472..130533 | - | 62 | NuclAT_1 | - | - |
| - (130472) | 130472..130533 | - | 62 | NuclAT_1 | - | - |
| - (130472) | 130472..130533 | - | 62 | NuclAT_1 | - | - |
| - (130472) | 130472..130533 | - | 62 | NuclAT_1 | - | - |
| QQA28_RS26130 (130577) | 130577..130726 | + | 150 | WP_001312851.1 | Hok/Gef family protein | - |
| QQA28_RS26135 (131010) | 131010..131267 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA28_RS26140 (131284) | 131284..131535 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA28_RS26145 (131526) | 131526..131573 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA28_RS26150 (131566) | 131566..132048 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA28_RS26155 (132041) | 132041..132898 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QQA28_RS26160 (133861) | 133861..134112 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQA28_RS26165 (134109) | 134109..134396 | + | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA28_RS26170 (134500) | 134500..134820 | + | 321 | Protein_137 | serine acetyltransferase | - |
| QQA28_RS26175 (134836) | 134836..135219 | - | 384 | WP_256343883.1 | IS1 family transposase | - |
| QQA28_RS26180 (135272) | 135272..136294 | + | 1023 | WP_000255956.1 | IS21-like element IS100 family transposase | - |
| QQA28_RS26185 (136291) | 136291..137073 | + | 783 | WP_001442137.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| QQA28_RS26190 (137128) | 137128..137492 | - | 365 | Protein_141 | IS1 family transposase | - |
| QQA28_RS26195 (137592) | 137592..138813 | + | 1222 | Protein_142 | ISL3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat | 1..191373 | 191373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11105.15 Da Isoelectric Point: 10.5832
>T283264 WP_000222760.1 NZ_CP126945:134109-134396 [Escherichia coli O1:K1:H7]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|