Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 121223..121848 | Replicon | plasmid pEND_Eco 16002 |
| Accession | NZ_CP126945 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQA28_RS26090 | Protein ID | WP_000911333.1 |
| Coordinates | 121223..121621 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | QQA28_RS26095 | Protein ID | WP_000450520.1 |
| Coordinates | 121621..121848 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS26075 (117554) | 117554..118063 | + | 510 | WP_000628105.1 | conjugal transfer entry exclusion protein TraS | - |
| QQA28_RS26080 (118077) | 118077..118808 | + | 732 | WP_000850416.1 | conjugal transfer complement resistance protein TraT | - |
| QQA28_RS26085 (119061) | 119061..121214 | + | 2154 | WP_039025869.1 | type IV conjugative transfer system coupling protein TraD | - |
| QQA28_RS26090 (121223) | 121223..121621 | - | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| QQA28_RS26095 (121621) | 121621..121848 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat | 1..191373 | 191373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T283263 WP_000911333.1 NZ_CP126945:c121621-121223 [Escherichia coli O1:K1:H7]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|