Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 76983..77508 | Replicon | plasmid pEND_Eco 16002 |
| Accession | NZ_CP126945 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | QQA28_RS25825 | Protein ID | WP_001159871.1 |
| Coordinates | 77203..77508 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | QQA28_RS25820 | Protein ID | WP_000813630.1 |
| Coordinates | 76983..77201 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS25790 (72399) | 72399..72815 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQA28_RS25795 (72812) | 72812..73042 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QQA28_RS25800 (73307) | 73307..73807 | + | 501 | WP_000528932.1 | HEPN family nuclease | - |
| QQA28_RS25805 (73820) | 73820..74593 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| QQA28_RS25810 (74760) | 74760..75893 | + | 1134 | WP_000545986.1 | DUF3800 domain-containing protein | - |
| QQA28_RS25815 (75927) | 75927..76415 | - | 489 | WP_011254646.1 | hypothetical protein | - |
| QQA28_RS25820 (76983) | 76983..77201 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QQA28_RS25825 (77203) | 77203..77508 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QQA28_RS25830 (77509) | 77509..78315 | + | 807 | WP_000016968.1 | site-specific integrase | - |
| QQA28_RS25835 (78995) | 78995..79726 | - | 732 | WP_000504262.1 | replication initiation protein | - |
| QQA28_RS25840 (80347) | 80347..81552 | + | 1206 | WP_001442122.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat | 1..191373 | 191373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T283259 WP_001159871.1 NZ_CP126945:77203-77508 [Escherichia coli O1:K1:H7]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |