Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 76983..77508 Replicon plasmid pEND_Eco 16002
Accession NZ_CP126945
Organism Escherichia coli O1:K1:H7 strain APEC E16002

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QQA28_RS25825 Protein ID WP_001159871.1
Coordinates 77203..77508 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QQA28_RS25820 Protein ID WP_000813630.1
Coordinates 76983..77201 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA28_RS25790 (72399) 72399..72815 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
QQA28_RS25795 (72812) 72812..73042 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
QQA28_RS25800 (73307) 73307..73807 + 501 WP_000528932.1 HEPN family nuclease -
QQA28_RS25805 (73820) 73820..74593 + 774 WP_000905949.1 hypothetical protein -
QQA28_RS25810 (74760) 74760..75893 + 1134 WP_000545986.1 DUF3800 domain-containing protein -
QQA28_RS25815 (75927) 75927..76415 - 489 WP_011254646.1 hypothetical protein -
QQA28_RS25820 (76983) 76983..77201 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QQA28_RS25825 (77203) 77203..77508 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QQA28_RS25830 (77509) 77509..78315 + 807 WP_000016968.1 site-specific integrase -
QQA28_RS25835 (78995) 78995..79726 - 732 WP_000504262.1 replication initiation protein -
QQA28_RS25840 (80347) 80347..81552 + 1206 WP_001442122.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat 1..191373 191373


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T283259 WP_001159871.1 NZ_CP126945:77203-77508 [Escherichia coli O1:K1:H7]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT283259 WP_000813630.1 NZ_CP126945:76983-77201 [Escherichia coli O1:K1:H7]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References