283258

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 72399..73042 Replicon plasmid pEND_Eco 16002
Accession NZ_CP126945
Organism Escherichia coli O1:K1:H7 strain APEC E16002

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QQA28_RS25790 Protein ID WP_001034046.1
Coordinates 72399..72815 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QQA28_RS25795 Protein ID WP_001261278.1
Coordinates 72812..73042 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA28_RS25775 (67536) 67536..67952 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QQA28_RS25780 (67949) 67949..68179 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QQA28_RS25785 (68560) 68560..72354 + 3795 WP_001144732.1 hypothetical protein -
QQA28_RS25790 (72399) 72399..72815 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA28_RS25795 (72812) 72812..73042 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA28_RS25800 (73307) 73307..73807 + 501 WP_000528932.1 HEPN family nuclease -
QQA28_RS25805 (73820) 73820..74593 + 774 WP_000905949.1 hypothetical protein -
QQA28_RS25810 (74760) 74760..75893 + 1134 WP_000545986.1 DUF3800 domain-containing protein -
QQA28_RS25815 (75927) 75927..76415 - 489 WP_011254646.1 hypothetical protein -
QQA28_RS25820 (76983) 76983..77201 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
QQA28_RS25825 (77203) 77203..77508 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat 1..191373 191373


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T283258 WP_001034046.1 NZ_CP126945:c72815-72399 [Escherichia coli O1:K1:H7]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT283258 WP_001261278.1 NZ_CP126945:c73042-72812 [Escherichia coli O1:K1:H7]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References