Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 67536..68179 Replicon plasmid pEND_Eco 16002
Accession NZ_CP126945
Organism Escherichia coli O1:K1:H7 strain APEC E16002

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QQA28_RS25775 Protein ID WP_001034044.1
Coordinates 67536..67952 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QQA28_RS25780 Protein ID WP_001261286.1
Coordinates 67949..68179 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA28_RS25760 (63938) 63938..64635 + 698 WP_223155668.1 IS1-like element IS1A family transposase -
QQA28_RS25765 (64889) 64889..65911 - 1023 WP_000361402.1 helicase UvrD -
QQA28_RS25770 (65896) 65896..67461 - 1566 WP_001128474.1 AAA family ATPase -
QQA28_RS25775 (67536) 67536..67952 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA28_RS25780 (67949) 67949..68179 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA28_RS25785 (68560) 68560..72354 + 3795 WP_001144732.1 hypothetical protein -
QQA28_RS25790 (72399) 72399..72815 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
QQA28_RS25795 (72812) 72812..73042 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / vat 1..191373 191373


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T283257 WP_001034044.1 NZ_CP126945:c67952-67536 [Escherichia coli O1:K1:H7]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT283257 WP_001261286.1 NZ_CP126945:c68179-67949 [Escherichia coli O1:K1:H7]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References