Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3693503..3694121 | Replicon | chromosome |
Accession | NZ_CP126944 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E16002 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQA28_RS18370 | Protein ID | WP_001291435.1 |
Coordinates | 3693903..3694121 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQA28_RS18365 | Protein ID | WP_000344800.1 |
Coordinates | 3693503..3693877 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA28_RS18355 (3688593) | 3688593..3689786 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QQA28_RS18360 (3689809) | 3689809..3692958 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQA28_RS18365 (3693503) | 3693503..3693877 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQA28_RS18370 (3693903) | 3693903..3694121 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQA28_RS18375 (3694295) | 3694295..3694846 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
QQA28_RS18380 (3694962) | 3694962..3695432 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QQA28_RS18385 (3695596) | 3695596..3697146 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQA28_RS18390 (3697188) | 3697188..3697541 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QQA28_RS18400 (3697920) | 3697920..3698231 | + | 312 | WP_000409908.1 | MGMT family protein | - |
QQA28_RS18405 (3698262) | 3698262..3698834 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283246 WP_001291435.1 NZ_CP126944:3693903-3694121 [Escherichia coli O1:K1:H7]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283246 WP_000344800.1 NZ_CP126944:3693503-3693877 [Escherichia coli O1:K1:H7]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |