Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1024347..1025001 | Replicon | chromosome |
| Accession | NZ_CP126944 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | QQA28_RS05060 | Protein ID | WP_000244781.1 |
| Coordinates | 1024594..1025001 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QQA28_RS05055 | Protein ID | WP_000354046.1 |
| Coordinates | 1024347..1024613 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS05035 (1020435) | 1020435..1021868 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
| QQA28_RS05040 (1021913) | 1021913..1022224 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| QQA28_RS05045 (1022388) | 1022388..1023047 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QQA28_RS05050 (1023124) | 1023124..1024104 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| QQA28_RS05055 (1024347) | 1024347..1024613 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QQA28_RS05060 (1024594) | 1024594..1025001 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| QQA28_RS05065 (1025041) | 1025041..1025562 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QQA28_RS05070 (1025674) | 1025674..1026570 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
| QQA28_RS05075 (1026595) | 1026595..1027305 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QQA28_RS05080 (1027311) | 1027311..1029044 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283236 WP_000244781.1 NZ_CP126944:1024594-1025001 [Escherichia coli O1:K1:H7]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|