Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 894308..895109 | Replicon | chromosome |
| Accession | NZ_CP126944 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QQA28_RS04385 | Protein ID | WP_226125982.1 |
| Coordinates | 894308..894685 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QQA28_RS04390 | Protein ID | WP_289251580.1 |
| Coordinates | 894732..895109 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS04355 (890279) | 890279..891541 | - | 1263 | WP_001218820.1 | integrase arm-type DNA-binding domain-containing protein | - |
| QQA28_RS04360 (892005) | 892005..892331 | - | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QQA28_RS04365 (892328) | 892328..892591 | - | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QQA28_RS04370 (892663) | 892663..893529 | - | 867 | WP_001280433.1 | DUF4942 domain-containing protein | - |
| QQA28_RS04375 (893614) | 893614..893811 | - | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QQA28_RS04380 (893823) | 893823..894311 | - | 489 | WP_000761676.1 | DUF5983 family protein | - |
| QQA28_RS04385 (894308) | 894308..894685 | - | 378 | WP_226125982.1 | TA system toxin CbtA family protein | Toxin |
| QQA28_RS04390 (894732) | 894732..895109 | - | 378 | WP_289251580.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQA28_RS04395 (895189) | 895189..895410 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| QQA28_RS04400 (895473) | 895473..895949 | - | 477 | WP_001366855.1 | RadC family protein | - |
| QQA28_RS04405 (895965) | 895965..896444 | - | 480 | WP_000844100.1 | antirestriction protein | - |
| QQA28_RS04410 (896526) | 896526..897344 | - | 819 | WP_001175148.1 | DUF932 domain-containing protein | - |
| QQA28_RS04415 (897434) | 897434..897667 | - | 234 | WP_072645932.1 | DUF905 family protein | - |
| QQA28_RS04420 (897673) | 897673..898350 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| QQA28_RS04425 (898498) | 898498..899178 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG | 695846..933584 | 237738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13947.86 Da Isoelectric Point: 7.2917
>T283235 WP_226125982.1 NZ_CP126944:c894685-894308 [Escherichia coli O1:K1:H7]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.56 Da Isoelectric Point: 6.4751
>AT283235 WP_289251580.1 NZ_CP126944:c895109-894732 [Escherichia coli O1:K1:H7]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|