Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 894308..895109 Replicon chromosome
Accession NZ_CP126944
Organism Escherichia coli O1:K1:H7 strain APEC E16002

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QQA28_RS04385 Protein ID WP_226125982.1
Coordinates 894308..894685 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QQA28_RS04390 Protein ID WP_289251580.1
Coordinates 894732..895109 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA28_RS04355 (890279) 890279..891541 - 1263 WP_001218820.1 integrase arm-type DNA-binding domain-containing protein -
QQA28_RS04360 (892005) 892005..892331 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
QQA28_RS04365 (892328) 892328..892591 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
QQA28_RS04370 (892663) 892663..893529 - 867 WP_001280433.1 DUF4942 domain-containing protein -
QQA28_RS04375 (893614) 893614..893811 - 198 WP_000839291.1 DUF957 domain-containing protein -
QQA28_RS04380 (893823) 893823..894311 - 489 WP_000761676.1 DUF5983 family protein -
QQA28_RS04385 (894308) 894308..894685 - 378 WP_226125982.1 TA system toxin CbtA family protein Toxin
QQA28_RS04390 (894732) 894732..895109 - 378 WP_289251580.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQA28_RS04395 (895189) 895189..895410 - 222 WP_000692309.1 DUF987 domain-containing protein -
QQA28_RS04400 (895473) 895473..895949 - 477 WP_001366855.1 RadC family protein -
QQA28_RS04405 (895965) 895965..896444 - 480 WP_000844100.1 antirestriction protein -
QQA28_RS04410 (896526) 896526..897344 - 819 WP_001175148.1 DUF932 domain-containing protein -
QQA28_RS04415 (897434) 897434..897667 - 234 WP_072645932.1 DUF905 family protein -
QQA28_RS04420 (897673) 897673..898350 - 678 WP_001097302.1 hypothetical protein -
QQA28_RS04425 (898498) 898498..899178 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 695846..933584 237738


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13947.86 Da        Isoelectric Point: 7.2917

>T283235 WP_226125982.1 NZ_CP126944:c894685-894308 [Escherichia coli O1:K1:H7]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.56 Da        Isoelectric Point: 6.4751

>AT283235 WP_289251580.1 NZ_CP126944:c895109-894732 [Escherichia coli O1:K1:H7]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References