Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 841921..842722 | Replicon | chromosome |
| Accession | NZ_CP126944 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E16002 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | QQA28_RS04105 | Protein ID | WP_001094436.1 |
| Coordinates | 841921..842298 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | QQA28_RS04110 | Protein ID | WP_015953067.1 |
| Coordinates | 842345..842722 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA28_RS04080 (838125) | 838125..838294 | - | 170 | Protein_802 | IS110 family transposase | - |
| QQA28_RS04085 (838691) | 838691..840226 | - | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
| QQA28_RS04090 (840297) | 840297..841142 | - | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
| QQA28_RS04095 (841227) | 841227..841424 | - | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| QQA28_RS04100 (841436) | 841436..841924 | - | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QQA28_RS04105 (841921) | 841921..842298 | - | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| QQA28_RS04110 (842345) | 842345..842722 | - | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA28_RS04115 (842801) | 842801..843022 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QQA28_RS04120 (843091) | 843091..843567 | - | 477 | WP_001186756.1 | RadC family protein | - |
| QQA28_RS04125 (843582) | 843582..844067 | - | 486 | WP_000860054.1 | antirestriction protein | - |
| QQA28_RS04130 (844158) | 844158..844976 | - | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QQA28_RS04135 (845066) | 845066..845299 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QQA28_RS04140 (845305) | 845305..845982 | - | 678 | WP_001097312.1 | hypothetical protein | - |
| QQA28_RS04145 (846130) | 846130..846810 | - | 681 | WP_001282927.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG | 695846..933584 | 237738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T283234 WP_001094436.1 NZ_CP126944:c842298-841921 [Escherichia coli O1:K1:H7]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT283234 WP_015953067.1 NZ_CP126944:c842722-842345 [Escherichia coli O1:K1:H7]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |