Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 841921..842722 Replicon chromosome
Accession NZ_CP126944
Organism Escherichia coli O1:K1:H7 strain APEC E16002

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QQA28_RS04105 Protein ID WP_001094436.1
Coordinates 841921..842298 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QQA28_RS04110 Protein ID WP_015953067.1
Coordinates 842345..842722 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA28_RS04080 (838125) 838125..838294 - 170 Protein_802 IS110 family transposase -
QQA28_RS04085 (838691) 838691..840226 - 1536 WP_000492897.1 EAL domain-containing protein -
QQA28_RS04090 (840297) 840297..841142 - 846 WP_001280513.1 DUF4942 domain-containing protein -
QQA28_RS04095 (841227) 841227..841424 - 198 WP_000839254.1 DUF957 domain-containing protein -
QQA28_RS04100 (841436) 841436..841924 - 489 WP_000761714.1 DUF5983 family protein -
QQA28_RS04105 (841921) 841921..842298 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QQA28_RS04110 (842345) 842345..842722 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA28_RS04115 (842801) 842801..843022 - 222 WP_000692312.1 DUF987 domain-containing protein -
QQA28_RS04120 (843091) 843091..843567 - 477 WP_001186756.1 RadC family protein -
QQA28_RS04125 (843582) 843582..844067 - 486 WP_000860054.1 antirestriction protein -
QQA28_RS04130 (844158) 844158..844976 - 819 WP_001175142.1 DUF932 domain-containing protein -
QQA28_RS04135 (845066) 845066..845299 - 234 WP_001278287.1 DUF905 family protein -
QQA28_RS04140 (845305) 845305..845982 - 678 WP_001097312.1 hypothetical protein -
QQA28_RS04145 (846130) 846130..846810 - 681 WP_001282927.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 695846..933584 237738


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T283234 WP_001094436.1 NZ_CP126944:c842298-841921 [Escherichia coli O1:K1:H7]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT283234 WP_015953067.1 NZ_CP126944:c842722-842345 [Escherichia coli O1:K1:H7]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References