283229

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 86266..86909 Replicon plasmid pEND_Eco 18006
Accession NZ_CP126943
Organism Escherichia coli O1:K1:H7 strain APEC E18006

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QQA29_RS25990 Protein ID WP_001034046.1
Coordinates 86493..86909 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QQA29_RS25985 Protein ID WP_001261278.1
Coordinates 86266..86496 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA29_RS25955 (81800) 81800..82105 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
QQA29_RS25960 (82107) 82107..82325 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
QQA29_RS25965 (82893) 82893..83381 + 489 WP_011254646.1 hypothetical protein -
QQA29_RS25970 (83415) 83415..84548 - 1134 WP_000545986.1 DUF3800 domain-containing protein -
QQA29_RS25975 (84715) 84715..85488 - 774 WP_000905949.1 hypothetical protein -
QQA29_RS25980 (85501) 85501..86001 - 501 WP_000528932.1 HEPN family nuclease -
QQA29_RS25985 (86266) 86266..86496 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA29_RS25990 (86493) 86493..86909 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA29_RS25995 (86954) 86954..90748 - 3795 WP_001144732.1 hypothetical protein -
QQA29_RS26000 (91129) 91129..91359 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QQA29_RS26005 (91356) 91356..91772 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..192699 192699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T283229 WP_001034046.1 NZ_CP126943:86493-86909 [Escherichia coli O1:K1:H7]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT283229 WP_001261278.1 NZ_CP126943:86266-86496 [Escherichia coli O1:K1:H7]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References