Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 81800..82325 | Replicon | plasmid pEND_Eco 18006 |
Accession | NZ_CP126943 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E18006 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | QQA29_RS25955 | Protein ID | WP_001159871.1 |
Coordinates | 81800..82105 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | QQA29_RS25960 | Protein ID | WP_000813630.1 |
Coordinates | 82107..82325 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA29_RS25940 (77756) | 77756..78961 | - | 1206 | WP_001442122.1 | AAA family ATPase | - |
QQA29_RS25945 (79582) | 79582..80313 | + | 732 | WP_000504262.1 | replication initiation protein | - |
QQA29_RS25950 (80993) | 80993..81799 | - | 807 | WP_000016968.1 | site-specific integrase | - |
QQA29_RS25955 (81800) | 81800..82105 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QQA29_RS25960 (82107) | 82107..82325 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QQA29_RS25965 (82893) | 82893..83381 | + | 489 | WP_011254646.1 | hypothetical protein | - |
QQA29_RS25970 (83415) | 83415..84548 | - | 1134 | WP_000545986.1 | DUF3800 domain-containing protein | - |
QQA29_RS25975 (84715) | 84715..85488 | - | 774 | WP_000905949.1 | hypothetical protein | - |
QQA29_RS25980 (85501) | 85501..86001 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
QQA29_RS25985 (86266) | 86266..86496 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QQA29_RS25990 (86493) | 86493..86909 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..192699 | 192699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T283228 WP_001159871.1 NZ_CP126943:c82105-81800 [Escherichia coli O1:K1:H7]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |