Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 81800..82325 Replicon plasmid pEND_Eco 18006
Accession NZ_CP126943
Organism Escherichia coli O1:K1:H7 strain APEC E18006

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QQA29_RS25955 Protein ID WP_001159871.1
Coordinates 81800..82105 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QQA29_RS25960 Protein ID WP_000813630.1
Coordinates 82107..82325 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA29_RS25940 (77756) 77756..78961 - 1206 WP_001442122.1 AAA family ATPase -
QQA29_RS25945 (79582) 79582..80313 + 732 WP_000504262.1 replication initiation protein -
QQA29_RS25950 (80993) 80993..81799 - 807 WP_000016968.1 site-specific integrase -
QQA29_RS25955 (81800) 81800..82105 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QQA29_RS25960 (82107) 82107..82325 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QQA29_RS25965 (82893) 82893..83381 + 489 WP_011254646.1 hypothetical protein -
QQA29_RS25970 (83415) 83415..84548 - 1134 WP_000545986.1 DUF3800 domain-containing protein -
QQA29_RS25975 (84715) 84715..85488 - 774 WP_000905949.1 hypothetical protein -
QQA29_RS25980 (85501) 85501..86001 - 501 WP_000528932.1 HEPN family nuclease -
QQA29_RS25985 (86266) 86266..86496 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
QQA29_RS25990 (86493) 86493..86909 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..192699 192699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T283228 WP_001159871.1 NZ_CP126943:c82105-81800 [Escherichia coli O1:K1:H7]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT283228 WP_000813630.1 NZ_CP126943:c82325-82107 [Escherichia coli O1:K1:H7]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References