Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 24912..25447 | Replicon | plasmid pEND_Eco 18006 |
| Accession | NZ_CP126943 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E18006 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | V0VJJ7 |
| Locus tag | QQA29_RS25615 | Protein ID | WP_000222760.1 |
| Coordinates | 24912..25199 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0VIP2 |
| Locus tag | QQA29_RS25620 | Protein ID | WP_001132900.1 |
| Coordinates | 25196..25447 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA29_RS25585 (20495) | 20495..21716 | - | 1222 | Protein_20 | ISL3 family transposase | - |
| QQA29_RS25590 (21816) | 21816..22180 | + | 365 | Protein_21 | IS1 family transposase | - |
| QQA29_RS25595 (22235) | 22235..23017 | - | 783 | WP_001442137.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| QQA29_RS25600 (23014) | 23014..24036 | - | 1023 | WP_000255956.1 | IS21-like element IS100 family transposase | - |
| QQA29_RS25605 (24125) | 24125..24472 | + | 348 | Protein_24 | IS1-like element IS1A family transposase | - |
| QQA29_RS25610 (24488) | 24488..24808 | - | 321 | Protein_25 | serine acetyltransferase | - |
| QQA29_RS25615 (24912) | 24912..25199 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQA29_RS25620 (25196) | 25196..25447 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQA29_RS25625 (26410) | 26410..27267 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QQA29_RS25630 (27260) | 27260..27742 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QQA29_RS25635 (27735) | 27735..27782 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QQA29_RS25640 (27773) | 27773..28024 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QQA29_RS25645 (28041) | 28041..28298 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QQA29_RS25650 (28582) | 28582..28731 | - | 150 | WP_001312851.1 | Hok/Gef family protein | - |
| - (28775) | 28775..28836 | + | 62 | NuclAT_1 | - | - |
| - (28775) | 28775..28836 | + | 62 | NuclAT_1 | - | - |
| - (28775) | 28775..28836 | + | 62 | NuclAT_1 | - | - |
| - (28775) | 28775..28836 | + | 62 | NuclAT_1 | - | - |
| QQA29_RS25655 (29092) | 29092..29166 | - | 75 | Protein_34 | endonuclease | - |
| QQA29_RS25660 (29412) | 29412..29624 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QQA29_RS25665 (29760) | 29760..30320 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..192699 | 192699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11105.15 Da Isoelectric Point: 10.5832
>T283222 WP_000222760.1 NZ_CP126943:c25199-24912 [Escherichia coli O1:K1:H7]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|