Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4351346..4352160 | Replicon | chromosome |
| Accession | NZ_CP126942 | ||
| Organism | Escherichia coli O1:K1:H7 strain APEC E18006 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | QQA29_RS21510 | Protein ID | WP_001054376.1 |
| Coordinates | 4351346..4351603 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | QQA29_RS21515 | Protein ID | WP_001309181.1 |
| Coordinates | 4351615..4352160 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA29_RS21485 (4346634) | 4346634..4347740 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| QQA29_RS21490 (4347805) | 4347805..4348785 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| QQA29_RS21495 (4348895) | 4348895..4349100 | + | 206 | Protein_4213 | HNH endonuclease | - |
| QQA29_RS21500 (4349368) | 4349368..4350608 | - | 1241 | Protein_4214 | helicase YjhR | - |
| QQA29_RS21505 (4350724) | 4350724..4350855 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| QQA29_RS21510 (4351346) | 4351346..4351603 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| QQA29_RS21515 (4351615) | 4351615..4352160 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| QQA29_RS21520 (4352216) | 4352216..4352962 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| QQA29_RS21525 (4353131) | 4353131..4353349 | + | 219 | Protein_4219 | hypothetical protein | - |
| QQA29_RS21530 (4353387) | 4353387..4353503 | + | 117 | Protein_4220 | VOC family protein | - |
| QQA29_RS21535 (4353748) | 4353748..4354869 | + | 1122 | WP_000010830.1 | M42 family metallopeptidase | - |
| QQA29_RS21540 (4354866) | 4354866..4355144 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| QQA29_RS21545 (4355156) | 4355156..4356469 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4343840..4360384 | 16544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T283218 WP_001054376.1 NZ_CP126942:4351346-4351603 [Escherichia coli O1:K1:H7]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT283218 WP_001309181.1 NZ_CP126942:4351615-4352160 [Escherichia coli O1:K1:H7]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|