Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1192167..1192750 | Replicon | chromosome |
Accession | NZ_CP126942 | ||
Organism | Escherichia coli O1:K1:H7 strain APEC E18006 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | QQA29_RS05780 | Protein ID | WP_000254750.1 |
Coordinates | 1192415..1192750 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QQA29_RS05775 | Protein ID | WP_000581937.1 |
Coordinates | 1192167..1192415 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA29_RS05765 (1188506) | 1188506..1189807 | + | 1302 | WP_000046816.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QQA29_RS05770 (1189855) | 1189855..1192089 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QQA29_RS05775 (1192167) | 1192167..1192415 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQA29_RS05780 (1192415) | 1192415..1192750 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
QQA29_RS05785 (1192822) | 1192822..1193613 | + | 792 | WP_001071651.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QQA29_RS05790 (1193841) | 1193841..1195478 | + | 1638 | WP_000210880.1 | CTP synthase (glutamine hydrolyzing) | - |
QQA29_RS05795 (1195566) | 1195566..1196864 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T283202 WP_000254750.1 NZ_CP126942:1192415-1192750 [Escherichia coli O1:K1:H7]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|