Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 894304..895105 Replicon chromosome
Accession NZ_CP126942
Organism Escherichia coli O1:K1:H7 strain APEC E18006

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QQA29_RS04385 Protein ID WP_226125982.1
Coordinates 894304..894681 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QQA29_RS04390 Protein ID WP_289251580.1
Coordinates 894728..895105 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA29_RS04355 (890275) 890275..891537 - 1263 WP_001218820.1 integrase arm-type DNA-binding domain-containing protein -
QQA29_RS04360 (892001) 892001..892327 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
QQA29_RS04365 (892324) 892324..892587 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
QQA29_RS04370 (892659) 892659..893525 - 867 WP_001280433.1 DUF4942 domain-containing protein -
QQA29_RS04375 (893610) 893610..893807 - 198 WP_000839291.1 DUF957 domain-containing protein -
QQA29_RS04380 (893819) 893819..894307 - 489 WP_000761676.1 DUF5983 family protein -
QQA29_RS04385 (894304) 894304..894681 - 378 WP_226125982.1 TA system toxin CbtA family protein Toxin
QQA29_RS04390 (894728) 894728..895105 - 378 WP_289251580.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQA29_RS04395 (895185) 895185..895406 - 222 WP_000692309.1 DUF987 domain-containing protein -
QQA29_RS04400 (895469) 895469..895945 - 477 WP_001366855.1 RadC family protein -
QQA29_RS04405 (895961) 895961..896440 - 480 WP_000844100.1 antirestriction protein -
QQA29_RS04410 (896522) 896522..897340 - 819 WP_001175148.1 DUF932 domain-containing protein -
QQA29_RS04415 (897430) 897430..897663 - 234 WP_072645932.1 DUF905 family protein -
QQA29_RS04420 (897669) 897669..898346 - 678 WP_001097302.1 hypothetical protein -
QQA29_RS04425 (898494) 898494..899174 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 695846..933580 237734


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13947.86 Da        Isoelectric Point: 7.2917

>T283200 WP_226125982.1 NZ_CP126942:c894681-894304 [Escherichia coli O1:K1:H7]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.56 Da        Isoelectric Point: 6.4751

>AT283200 WP_289251580.1 NZ_CP126942:c895105-894728 [Escherichia coli O1:K1:H7]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References