Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 841917..842718 Replicon chromosome
Accession NZ_CP126942
Organism Escherichia coli O1:K1:H7 strain APEC E18006

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QQA29_RS04105 Protein ID WP_001094436.1
Coordinates 841917..842294 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QQA29_RS04110 Protein ID WP_015953067.1
Coordinates 842341..842718 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA29_RS04080 (838121) 838121..838290 - 170 Protein_802 IS110 family transposase -
QQA29_RS04085 (838687) 838687..840222 - 1536 WP_000492897.1 EAL domain-containing protein -
QQA29_RS04090 (840293) 840293..841138 - 846 WP_001280513.1 DUF4942 domain-containing protein -
QQA29_RS04095 (841223) 841223..841420 - 198 WP_000839254.1 DUF957 domain-containing protein -
QQA29_RS04100 (841432) 841432..841920 - 489 WP_000761714.1 DUF5983 family protein -
QQA29_RS04105 (841917) 841917..842294 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QQA29_RS04110 (842341) 842341..842718 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA29_RS04115 (842797) 842797..843018 - 222 WP_000692312.1 DUF987 domain-containing protein -
QQA29_RS04120 (843087) 843087..843563 - 477 WP_001186756.1 RadC family protein -
QQA29_RS04125 (843578) 843578..844063 - 486 WP_000860054.1 antirestriction protein -
QQA29_RS04130 (844154) 844154..844972 - 819 WP_001175142.1 DUF932 domain-containing protein -
QQA29_RS04135 (845062) 845062..845295 - 234 WP_001278287.1 DUF905 family protein -
QQA29_RS04140 (845301) 845301..845978 - 678 WP_001097312.1 hypothetical protein -
QQA29_RS04145 (846126) 846126..846806 - 681 WP_001282927.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 695846..933580 237734


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T283199 WP_001094436.1 NZ_CP126942:c842294-841917 [Escherichia coli O1:K1:H7]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT283199 WP_015953067.1 NZ_CP126942:c842718-842341 [Escherichia coli O1:K1:H7]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References