Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 163586..164211 | Replicon | plasmid pEND_Eco 18055 |
Accession | NZ_CP126941 | ||
Organism | Escherichia coli O2:K1:H7 strain APEC E18055 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QQA30_RS26175 | Protein ID | WP_000911333.1 |
Coordinates | 163813..164211 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | QQA30_RS26170 | Protein ID | WP_000450520.1 |
Coordinates | 163586..163813 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA30_RS26170 (163586) | 163586..163813 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QQA30_RS26175 (163813) | 163813..164211 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QQA30_RS26180 (164220) | 164220..166373 | - | 2154 | WP_000009379.1 | type IV conjugative transfer system coupling protein TraD | - |
QQA30_RS26185 (166626) | 166626..167357 | - | 732 | WP_000850416.1 | conjugal transfer complement resistance protein TraT | - |
QQA30_RS26190 (167371) | 167371..167880 | - | 510 | WP_000628105.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..199896 | 199896 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T283192 WP_000911333.1 NZ_CP126941:163813-164211 [Escherichia coli O2:K1:H7]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|