Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 19730..20373 | Replicon | plasmid pEND_Eco 18055 |
Accession | NZ_CP126941 | ||
Organism | Escherichia coli O2:K1:H7 strain APEC E18055 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | QQA30_RS25445 | Protein ID | WP_001034044.1 |
Coordinates | 19957..20373 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | QQA30_RS25440 | Protein ID | WP_001261286.1 |
Coordinates | 19730..19960 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA30_RS25420 (14885) | 14885..15310 | - | 426 | WP_021514830.1 | transposase | - |
QQA30_RS25425 (15397) | 15397..15510 | + | 114 | Protein_17 | VapC toxin family PIN domain ribonuclease | - |
QQA30_RS25430 (15555) | 15555..18767 | - | 3213 | WP_289251513.1 | pcar | - |
QQA30_RS25435 (18855) | 18855..19379 | - | 525 | WP_289251514.1 | hypothetical protein | - |
QQA30_RS25440 (19730) | 19730..19960 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QQA30_RS25445 (19957) | 19957..20373 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QQA30_RS25450 (20448) | 20448..22013 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
QQA30_RS25455 (21998) | 21998..23020 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..199896 | 199896 | |
- | flank | IS/Tn | - | - | 23274..23777 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T283189 WP_001034044.1 NZ_CP126941:19957-20373 [Escherichia coli O2:K1:H7]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |