Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3739033..3739651 | Replicon | chromosome |
| Accession | NZ_CP126940 | ||
| Organism | Escherichia coli O2:K1:H7 strain APEC E18055 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QQA30_RS18620 | Protein ID | WP_001291435.1 |
| Coordinates | 3739433..3739651 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QQA30_RS18615 | Protein ID | WP_000344800.1 |
| Coordinates | 3739033..3739407 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA30_RS18605 (3734123) | 3734123..3735316 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QQA30_RS18610 (3735339) | 3735339..3738488 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| QQA30_RS18615 (3739033) | 3739033..3739407 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QQA30_RS18620 (3739433) | 3739433..3739651 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QQA30_RS18625 (3739825) | 3739825..3740376 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
| QQA30_RS18630 (3740492) | 3740492..3740962 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QQA30_RS18635 (3741126) | 3741126..3742676 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QQA30_RS18640 (3742718) | 3742718..3743071 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QQA30_RS18650 (3743450) | 3743450..3743761 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QQA30_RS18655 (3743792) | 3743792..3744364 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283182 WP_001291435.1 NZ_CP126940:3739433-3739651 [Escherichia coli O2:K1:H7]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283182 WP_000344800.1 NZ_CP126940:3739033-3739407 [Escherichia coli O2:K1:H7]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |