Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2075959..2076790 Replicon chromosome
Accession NZ_CP126940
Organism Escherichia coli O2:K1:H7 strain APEC E18055

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQA30_RS10350 Protein ID WP_000854814.1
Coordinates 2075959..2076333 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag QQA30_RS10355 Protein ID WP_001285586.1
Coordinates 2076422..2076790 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA30_RS10310 (2071355) 2071355..2072521 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QQA30_RS10315 (2072640) 2072640..2073113 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
QQA30_RS10320 (2073311) 2073311..2074369 + 1059 WP_289251503.1 FUSC family protein -
QQA30_RS10325 (2074541) 2074541..2074870 + 330 WP_000450409.1 DUF496 family protein -
QQA30_RS10330 (2074971) 2074971..2075105 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QQA30_RS10335 (2075207) 2075207..2075353 + 147 Protein_2029 transposase domain-containing protein -
QQA30_RS10340 (2075642) 2075642..2075722 - 81 Protein_2030 hypothetical protein -
QQA30_RS10345 (2075768) 2075768..2075962 - 195 WP_000988601.1 DUF5983 family protein -
QQA30_RS10350 (2075959) 2075959..2076333 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQA30_RS10355 (2076422) 2076422..2076790 - 369 WP_001285586.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA30_RS10360 (2076864) 2076864..2077085 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQA30_RS10365 (2077154) 2077154..2077630 - 477 WP_001351157.1 RadC family protein -
QQA30_RS10370 (2077646) 2077646..2078131 - 486 WP_000213703.1 antirestriction protein -
QQA30_RS10375 (2078222) 2078222..2079043 - 822 WP_001234569.1 DUF932 domain-containing protein -
QQA30_RS10380 (2079264) 2079264..2079674 - 411 WP_000846704.1 hypothetical protein -
QQA30_RS10385 (2079690) 2079690..2080366 - 677 Protein_2039 hypothetical protein -
QQA30_RS10390 (2080502) 2080502..2081572 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T283174 WP_000854814.1 NZ_CP126940:c2076333-2075959 [Escherichia coli O2:K1:H7]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT283174 WP_001285586.1 NZ_CP126940:c2076790-2076422 [Escherichia coli O2:K1:H7]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References