Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2075959..2076790 | Replicon | chromosome |
| Accession | NZ_CP126940 | ||
| Organism | Escherichia coli O2:K1:H7 strain APEC E18055 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QQA30_RS10350 | Protein ID | WP_000854814.1 |
| Coordinates | 2075959..2076333 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1PWQ3 |
| Locus tag | QQA30_RS10355 | Protein ID | WP_001285586.1 |
| Coordinates | 2076422..2076790 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA30_RS10310 (2071355) | 2071355..2072521 | + | 1167 | WP_001297905.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| QQA30_RS10315 (2072640) | 2072640..2073113 | + | 474 | WP_001105376.1 | DNA gyrase inhibitor SbmC | - |
| QQA30_RS10320 (2073311) | 2073311..2074369 | + | 1059 | WP_289251503.1 | FUSC family protein | - |
| QQA30_RS10325 (2074541) | 2074541..2074870 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QQA30_RS10330 (2074971) | 2074971..2075105 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| QQA30_RS10335 (2075207) | 2075207..2075353 | + | 147 | Protein_2029 | transposase domain-containing protein | - |
| QQA30_RS10340 (2075642) | 2075642..2075722 | - | 81 | Protein_2030 | hypothetical protein | - |
| QQA30_RS10345 (2075768) | 2075768..2075962 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QQA30_RS10350 (2075959) | 2075959..2076333 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQA30_RS10355 (2076422) | 2076422..2076790 | - | 369 | WP_001285586.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA30_RS10360 (2076864) | 2076864..2077085 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QQA30_RS10365 (2077154) | 2077154..2077630 | - | 477 | WP_001351157.1 | RadC family protein | - |
| QQA30_RS10370 (2077646) | 2077646..2078131 | - | 486 | WP_000213703.1 | antirestriction protein | - |
| QQA30_RS10375 (2078222) | 2078222..2079043 | - | 822 | WP_001234569.1 | DUF932 domain-containing protein | - |
| QQA30_RS10380 (2079264) | 2079264..2079674 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QQA30_RS10385 (2079690) | 2079690..2080366 | - | 677 | Protein_2039 | hypothetical protein | - |
| QQA30_RS10390 (2080502) | 2080502..2081572 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T283174 WP_000854814.1 NZ_CP126940:c2076333-2075959 [Escherichia coli O2:K1:H7]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13563.41 Da Isoelectric Point: 5.0468
>AT283174 WP_001285586.1 NZ_CP126940:c2076790-2076422 [Escherichia coli O2:K1:H7]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PWQ3 |