Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1121841..1122424 | Replicon | chromosome |
| Accession | NZ_CP126940 | ||
| Organism | Escherichia coli O2:K1:H7 strain APEC E18055 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | V0SV58 |
| Locus tag | QQA30_RS05460 | Protein ID | WP_000254750.1 |
| Coordinates | 1122089..1122424 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | QQA30_RS05455 | Protein ID | WP_000581937.1 |
| Coordinates | 1121841..1122089 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA30_RS05445 (1118180) | 1118180..1119481 | + | 1302 | WP_000046816.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| QQA30_RS05450 (1119529) | 1119529..1121763 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| QQA30_RS05455 (1121841) | 1121841..1122089 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QQA30_RS05460 (1122089) | 1122089..1122424 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
| QQA30_RS05465 (1122496) | 1122496..1123287 | + | 792 | WP_001071651.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| QQA30_RS05470 (1123515) | 1123515..1125152 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| QQA30_RS05475 (1125240) | 1125240..1126538 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T283172 WP_000254750.1 NZ_CP126940:1122089-1122424 [Escherichia coli O2:K1:H7]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|