Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 967899..968553 | Replicon | chromosome |
Accession | NZ_CP126940 | ||
Organism | Escherichia coli O2:K1:H7 strain APEC E18055 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QQA30_RS04825 | Protein ID | WP_000244781.1 |
Coordinates | 968146..968553 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QQA30_RS04820 | Protein ID | WP_000354046.1 |
Coordinates | 967899..968165 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA30_RS04800 (963987) | 963987..965420 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
QQA30_RS04805 (965465) | 965465..965776 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QQA30_RS04810 (965940) | 965940..966599 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QQA30_RS04815 (966676) | 966676..967656 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
QQA30_RS04820 (967899) | 967899..968165 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QQA30_RS04825 (968146) | 968146..968553 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QQA30_RS04830 (968593) | 968593..969114 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QQA30_RS04835 (969226) | 969226..970122 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
QQA30_RS04840 (970147) | 970147..970857 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QQA30_RS04845 (970863) | 970863..972596 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283171 WP_000244781.1 NZ_CP126940:968146-968553 [Escherichia coli O2:K1:H7]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|