Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 849804..850605 Replicon chromosome
Accession NZ_CP126940
Organism Escherichia coli O2:K1:H7 strain APEC E18055

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QQA30_RS04190 Protein ID WP_001094436.1
Coordinates 849804..850181 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QQA30_RS04195 Protein ID WP_015953067.1
Coordinates 850228..850605 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA30_RS04165 (846007) 846007..846177 - 171 Protein_819 IS110 family transposase -
QQA30_RS04170 (846574) 846574..848109 - 1536 WP_000492897.1 EAL domain-containing protein -
QQA30_RS04175 (848180) 848180..849025 - 846 WP_001280513.1 DUF4942 domain-containing protein -
QQA30_RS04180 (849110) 849110..849307 - 198 WP_000839254.1 DUF957 domain-containing protein -
QQA30_RS04185 (849319) 849319..849807 - 489 WP_000761714.1 DUF5983 family protein -
QQA30_RS04190 (849804) 849804..850181 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QQA30_RS04195 (850228) 850228..850605 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQA30_RS04200 (850684) 850684..850905 - 222 WP_000692312.1 DUF987 domain-containing protein -
QQA30_RS04205 (850974) 850974..851450 - 477 WP_001186782.1 RadC family protein -
QQA30_RS04210 (851465) 851465..851950 - 486 WP_000860054.1 antirestriction protein -
QQA30_RS04215 (852041) 852041..852859 - 819 WP_001175142.1 DUF932 domain-containing protein -
QQA30_RS04220 (852949) 852949..853182 - 234 WP_001278287.1 DUF905 family protein -
QQA30_RS04225 (853188) 853188..853865 - 678 WP_001097312.1 hypothetical protein -
QQA30_RS04230 (854013) 854013..854693 - 681 WP_001282927.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 709005..898770 189765
- flank IS/Tn - - 846007..846111 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T283170 WP_001094436.1 NZ_CP126940:c850181-849804 [Escherichia coli O2:K1:H7]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT283170 WP_015953067.1 NZ_CP126940:c850605-850228 [Escherichia coli O2:K1:H7]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References