283169

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 123847..124394 Replicon plasmid pEND_Eco 19019-1
Accession NZ_CP126938
Organism Escherichia coli O2:K1:H4 strain APEC E19019

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QQA31_RS24590 Protein ID WP_001384452.1
Coordinates 123847..124125 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag QQA31_RS24595 Protein ID WP_000079941.1
Coordinates 124125..124394 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA31_RS24560 (119277) 119277..119537 + 261 WP_000343091.1 hypothetical protein -
QQA31_RS24565 (119534) 119534..120124 + 591 WP_001350923.1 hypothetical protein -
QQA31_RS24570 (120186) 120186..120401 - 216 Protein_136 DUF6404 family protein -
QQA31_RS24575 (120530) 120530..120865 + 336 WP_001080729.1 colicin 1A immunity protein -
QQA31_RS24580 (120887) 120887..122767 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
QQA31_RS24585 (122953) 122953..123801 - 849 WP_001057989.1 3'-5' exonuclease -
QQA31_RS24590 (123847) 123847..124125 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QQA31_RS24595 (124125) 124125..124394 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QQA31_RS24600 (125310) 125310..126167 - 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
QQA31_RS24605 (126160) 126160..126207 - 48 WP_077822033.1 hypothetical protein -
QQA31_RS24610 (126198) 126198..126434 + 237 WP_223368648.1 replication protein RepA -
QQA31_RS24615 (126460) 126460..126720 - 261 WP_000083818.1 replication regulatory protein RepA -
QQA31_RS24620 (126810) 126810..127166 - 357 Protein_146 thermonuclease family protein -
QQA31_RS24625 (127409) 127409..127621 - 213 WP_001311693.1 hypothetical protein -
QQA31_RS24630 (127759) 127759..128319 - 561 WP_000139359.1 fertility inhibition protein FinO -
QQA31_RS24635 (128374) 128374..129120 - 747 WP_000205759.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN 1..166150 166150


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T283169 WP_001384452.1 NZ_CP126938:c124125-123847 [Escherichia coli O2:K1:H4]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT283169 WP_000079941.1 NZ_CP126938:c124394-124125 [Escherichia coli O2:K1:H4]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References