Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelE-RHH |
| Location | 123847..124394 | Replicon | plasmid pEND_Eco 19019-1 |
| Accession | NZ_CP126938 | ||
| Organism | Escherichia coli O2:K1:H4 strain APEC E19019 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G7QEJ9 |
| Locus tag | QQA31_RS24590 | Protein ID | WP_001384452.1 |
| Coordinates | 123847..124125 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | E1QMW3 |
| Locus tag | QQA31_RS24595 | Protein ID | WP_000079941.1 |
| Coordinates | 124125..124394 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA31_RS24560 (119277) | 119277..119537 | + | 261 | WP_000343091.1 | hypothetical protein | - |
| QQA31_RS24565 (119534) | 119534..120124 | + | 591 | WP_001350923.1 | hypothetical protein | - |
| QQA31_RS24570 (120186) | 120186..120401 | - | 216 | Protein_136 | DUF6404 family protein | - |
| QQA31_RS24575 (120530) | 120530..120865 | + | 336 | WP_001080729.1 | colicin 1A immunity protein | - |
| QQA31_RS24580 (120887) | 120887..122767 | - | 1881 | WP_001283335.1 | colicin Ia central receptor-binding domain-containing protein | - |
| QQA31_RS24585 (122953) | 122953..123801 | - | 849 | WP_001057989.1 | 3'-5' exonuclease | - |
| QQA31_RS24590 (123847) | 123847..124125 | - | 279 | WP_001384452.1 | type II toxin-antitoxin system toxin YacB | Toxin |
| QQA31_RS24595 (124125) | 124125..124394 | - | 270 | WP_000079941.1 | type II toxin-antitoxin system antitoxin YacA | Antitoxin |
| QQA31_RS24600 (125310) | 125310..126167 | - | 858 | WP_000130940.1 | incFII family plasmid replication initiator RepA | - |
| QQA31_RS24605 (126160) | 126160..126207 | - | 48 | WP_077822033.1 | hypothetical protein | - |
| QQA31_RS24610 (126198) | 126198..126434 | + | 237 | WP_223368648.1 | replication protein RepA | - |
| QQA31_RS24615 (126460) | 126460..126720 | - | 261 | WP_000083818.1 | replication regulatory protein RepA | - |
| QQA31_RS24620 (126810) | 126810..127166 | - | 357 | Protein_146 | thermonuclease family protein | - |
| QQA31_RS24625 (127409) | 127409..127621 | - | 213 | WP_001311693.1 | hypothetical protein | - |
| QQA31_RS24630 (127759) | 127759..128319 | - | 561 | WP_000139359.1 | fertility inhibition protein FinO | - |
| QQA31_RS24635 (128374) | 128374..129120 | - | 747 | WP_000205759.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN | 1..166150 | 166150 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10762.38 Da Isoelectric Point: 8.4615
>T283169 WP_001384452.1 NZ_CP126938:c124125-123847 [Escherichia coli O2:K1:H4]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CL36 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A629TXC5 |