Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4147995..4148809 | Replicon | chromosome |
Accession | NZ_CP126937 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E19019 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | QQA31_RS20245 | Protein ID | WP_001054376.1 |
Coordinates | 4147995..4148252 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | A0A8E0IVE5 |
Locus tag | QQA31_RS20250 | Protein ID | WP_001350781.1 |
Coordinates | 4148264..4148809 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA31_RS20220 (4143283) | 4143283..4144389 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
QQA31_RS20225 (4144454) | 4144454..4145434 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
QQA31_RS20230 (4145544) | 4145544..4145749 | + | 206 | Protein_3962 | HNH endonuclease | - |
QQA31_RS20235 (4146017) | 4146017..4147257 | - | 1241 | Protein_3963 | helicase YjhR | - |
QQA31_RS20240 (4147373) | 4147373..4147504 | + | 132 | WP_001309182.1 | hypothetical protein | - |
QQA31_RS20245 (4147995) | 4147995..4148252 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
QQA31_RS20250 (4148264) | 4148264..4148809 | + | 546 | WP_001350781.1 | N-acetyltransferase | Antitoxin |
QQA31_RS20255 (4148865) | 4148865..4149611 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
QQA31_RS20260 (4149780) | 4149780..4149998 | + | 219 | Protein_3968 | hypothetical protein | - |
QQA31_RS20265 (4150036) | 4150036..4150152 | + | 117 | Protein_3969 | VOC family protein | - |
QQA31_RS20270 (4150397) | 4150397..4151518 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
QQA31_RS20275 (4151515) | 4151515..4151793 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
QQA31_RS20280 (4151805) | 4151805..4153118 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4137780..4157033 | 19253 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T283166 WP_001054376.1 NZ_CP126937:4147995-4148252 [Escherichia coli O2:K1:H4]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19974.91 Da Isoelectric Point: 6.3277
>AT283166 WP_001350781.1 NZ_CP126937:4148264-4148809 [Escherichia coli O2:K1:H4]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAFIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAFIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|