Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3526526..3527144 | Replicon | chromosome |
Accession | NZ_CP126937 | ||
Organism | Escherichia coli O2:K1:H4 strain APEC E19019 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQA31_RS17240 | Protein ID | WP_001291435.1 |
Coordinates | 3526926..3527144 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQA31_RS17235 | Protein ID | WP_000344800.1 |
Coordinates | 3526526..3526900 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA31_RS17225 (3521616) | 3521616..3522809 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QQA31_RS17230 (3522832) | 3522832..3525981 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQA31_RS17235 (3526526) | 3526526..3526900 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQA31_RS17240 (3526926) | 3526926..3527144 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQA31_RS17245 (3527318) | 3527318..3527869 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
QQA31_RS17250 (3527985) | 3527985..3528455 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QQA31_RS17255 (3528619) | 3528619..3530169 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQA31_RS17260 (3530211) | 3530211..3530564 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QQA31_RS17270 (3530943) | 3530943..3531254 | + | 312 | WP_000409908.1 | MGMT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3531284..3532612 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283159 WP_001291435.1 NZ_CP126937:3526926-3527144 [Escherichia coli O2:K1:H4]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283159 WP_000344800.1 NZ_CP126937:3526526-3526900 [Escherichia coli O2:K1:H4]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |